KEGG   Arabidopsis thaliana (thale cress): AT4G32660Help
Entry
AT4G32660         CDS       T00041                                 

Gene name
AME3
Definition
(RefSeq) Protein kinase superfamily protein
  KO
K08287  dual-specificity kinase [EC:2.7.12.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AT4G32660 (AME3)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     AT4G32660 (AME3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like
Motif
Other DBs
NCBI-GeneID: 829401
NCBI-ProteinID: NP_194992
MIPS: AT4G32660.1
TAIR: AT4G32660
Araport: AT4G32660
UniProt: P51568 A1L4Y9
Position
4
AA seq 400 aa AA seqDB search
MIANGFESMDKERVRKRPRMTWDEAPAEPEAKRAVIKGHGSDGRILSPPLRDDDRDGHYV
FSLRDNLTPRYKILSKMGEGTFGRVLECWDRDTKEYVAIKIIRSIKKYRDAAMIEIDVLQ
KLVKSDKGRTRCVQMKNWFDYRNHICIVFEKLGPSLFDFLKRNKYSAFPLALVRDFGCQL
LESVAYMHELQLVHTDLKPENILLVSSENVKLPDNKRSAANETHFRCLPKSSAIKLIDFG
STVCDNRIHHSIVQTRHYRSPEVILGLGWSYQCDLWSIGCILFELCTGEALFQTHDNLEH
LAMMERALGPLPEHMTRKASRGAEKYFRRGCRLNWPEGANSRESIRAVKRLDRLKDMVSK
HVDNTRSRFADLLYGLLAYDPSERLTANEALDHPFFKSSS
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgatagctaacggattcgagagtatggataaagaacgagtcaggaaacgtcctcgtatg
acctgggacgaggccccagctgaaccagaggctaaaagggctgtgattaaaggacatgga
agcgatgggaggattttgtcaccaccattaagggacgatgatcgtgatggtcattatgtt
ttcagtttgagggacaatctcactcctagatataaaatacttagcaagatgggtgaaggc
acatttggtcgggttttggaatgttgggatcgtgatacaaaagaatatgtggcaataaag
ataattcgaagcattaagaaataccgggatgcagcaatgattgaaattgatgtacttcag
aaacttgttaagagtgataaaggccgcacacgctgtgtacagatgaagaactggtttgat
taccgaaatcatatttgcattgtgttcgagaagcttgggccaagtttgtttgactttcta
aagagaaataaatactccgcatttcctctggcccttgttcgggattttggatgccagctt
ttggaatctgtagcatatatgcacgagttacagttagttcacaccgacctcaagcctgag
aacattctgttggtgtcttctgaaaatgtaaagcttcctgacaataagaggagtgctgca
aatgagacacatttcaggtgcttaccaaagtcaagcgccattaaactgattgattttggc
agtactgtttgtgataaccggattcatcactccattgtccaaacaagacattacagatcc
cccgaggtcattttaggtctaggatggagttaccagtgtgacttatggagtataggttgt
atactatttgaactatgcacgggtgaggctctctttcagacgcatgataacctagaacat
ctagctatgatggagagggcgcttggacctttacctgaacatatgactcgaaaagccagc
cggggtgctgagaaatatttcaggagagggtgtcggttgaattggccagaaggagccaac
tctagagaaagtattagggctgtaaaaagacttgatcgtctcaaggatatggtatcgaaa
catgttgacaacacgagatctagatttgcagatctattgtatggtttattggcatatgat
ccatctgagcgtctcacagcaaacgaagctcttgaccatcctttctttaagagctcaagt
tga

DBGET integrated database retrieval system