KEGG   Arabidopsis thaliana (thale cress): AT4G32760Help
Entry
AT4G32760         CDS       T00041                                 

Definition
(RefSeq) ENTH/VHS/GAT family protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: VHS GAT DUF3730 SPACA9
Motif
Other DBs
NCBI-GeneID: 829412
NCBI-ProteinID: NP_195002
MIPS: AT4G32760.1
TAIR: AT4G32760
Araport: AT4G32760
UniProt: Q8L860
Position
4
AA seq 675 aa AA seqDB search
MVNAMVERATSEMLIGPDWAMNLEICDMLNSDPAQAKDVVKGIKKRIGSRNPKAQLLALT
LLETIVKNCGDMVHMHVAEKGVIHEMVRIVKKKPDFHVKEKILVLIDTWQEAFGGPRARY
PQYYAGYQELLRAGAVFPQRSERSAPVFTPPQTQPLTSYPPNLRNAGPGNDVPEPSAEPE
FPTLSLSEIQNAKGIMDVLAEMLSALEPGNKEDLKQEVMVDLVEQCRTYKQRVVHLVNST
SDESLLCQGLALNDDLQRVLTNYEAIASGLPGTSSQIEKPKSETGKSLVDVDGPLIDTGD
SSNQANGATSSSGNGVLNQLALPAPPVTNGSANSKIDLLSGDDLALVPVGPPQPASPVAS
DQNALALIDMFSDNTNNPSPATAPSGNPAQNIPLNPQGHQQPNSQAGEAGLQQSNGFAPQ
VGYSQFEQPSYGQGVSSPWSSQPAQQPVQPSYGAQDSTAFPPPPWEAQLQDYSPSAESGS
PFSPGMHPTQTAFTHAQPVNNNNPYPQIPQTGPPVNNNSPYAQMPQTGQAVANISPYPQI
PQNGVYMPNQPNQALGSGYQPQQQQQQQMMMAQYYAQQQQLQQQQQQQAYGNQMGGYGYG
YNQQQQGSSPYLDQQMYGLSMRDQTSHQVASSSSTTSYLPPMKPKNKPEDKLFGDLVDIS
KFKPTKPTSGRAGTM
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggtgaacgctatggtggagagagcgacgagcgagatgctgatcgggcctgattgggct
atgaacctcgagatctgtgatatgctcaatagcgatccagcgcaagcaaaagatgttgtg
aaaggcattaaaaaacggattggtagcaggaatccaaaagctcagcttcttgccttaact
ctgcttgagacaatagtgaagaactgtggtgacatggttcatatgcatgtggctgagaaa
ggtgttattcatgagatggtccggatagttaagaagaagccggacttccatgtcaaagag
aagattctggtccttatcgatacatggcaagaggcctttggtggccctagggcaagatat
ccacaatactatgcaggataccaggaattgttgcgtgctggtgctgttttccctcagaga
tcagagagatcagctcctgtgttcacacctcctcaaacacagcctttgacatcttaccct
ccaaatcttcgtaacgctggacctggtaatgatgtgcctgaaccttcagcagagccagaa
tttccgactctaagtttgtcggagattcaaaatgcaaaaggtatcatggatgtgcttgcg
gagatgctgagtgcattagagcccggaaacaaggaggatctcaaacaagaggttatggtc
gatctggtggagcagtgtcgtacatacaaacaaagagtggtgcacctcgtcaactcgact
tcggacgagtctttgttatgtcaaggtctggctttgaatgatgacttgcagcgtgtctta
accaattatgaagcaattgcttctggattacctggaacttcttctcagatcgagaagccc
aagtccgagacaggaaaatcccttgttgatgttgatggtccacttattgatacaggggac
agcagtaatcaggcgaacggagctacatcgagctctggtaacggggttctaaatcagttg
gccctccctgcaccacctgtaactaatggttcagccaattccaaaatagacctcctcagt
ggcgatgatcttgcccttgttcctgttggacctcctcagccagcaagtccggttgcatca
gatcaaaatgcactcgcccttatcgacatgttctcagataatactaataatccaagtcct
gcaactgcaccaagtggcaatccagctcagaatattcctttgaatcctcaagggcaccaa
caaccaaatagtcaagctggagaagctggattacaacaatccaatggatttgcgcctcaa
gtgggttattcgcagtttgagcagccatcatacgggcaaggagtctcttctccctggagc
agtcagcctgcacagcaaccagtccagccatcttatggtgcccaagacagtacggcattt
ccacctcccccatgggaagctcagctccaagactatagtccctctgcggagtcaggaagt
ccgttttctcctggaatgcatccaactcagactgccttcacacatgctcaaccagttaac
aacaacaatccatatcctcaaattccccaaaccgggccaccagtcaacaataacagtcca
tatgctcaaatgccccaaacaggtcaagcagttgccaacatcagtccatatcctcaaatt
ccacaaaacggcgtgtacatgccaaaccaaccaaatcaggctcttgggtcaggctatcaa
ccacagcaacaacagcagcagcagatgatgatggctcagtactatgcccaacagcaacag
ctacagcaacaacaacagcaacaggcgtatggaaaccagatgggaggatacggatatggc
tataatcaacagcaacaaggaagcagcccatatctggaccagcaaatgtacggtttatcc
atgagagaccagacatcgcatcaggtagcatcatcatcatctaccacatcttatctgcct
ccaatgaaacctaagaataaaccagaggacaagctatttggggatcttgtggacatctcc
aaattcaagcctacaaaaccgacttccggaagagctggtaccatgtga

DBGET integrated database retrieval system