KEGG   Arabidopsis thaliana (thale cress): AT4G32980Help
Entry
AT4G32980         CDS       T00041                                 

Gene name
ATH1
Definition
(RefSeq) homeobox protein ATH1
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: POX Homeobox_KN Homeobox
Motif
Other DBs
NCBI-GeneID: 829435
NCBI-ProteinID: NP_001328067
MIPS: AT4G32980.1
TAIR: AT4G32980
Araport: AT4G32980
UniProt: P48731
Position
4
AA seq 473 aa AA seqDB search
MDNNNNNNTFSSLDNVMTNQNPLLMDFIPSREDSTSFSTMLPWNTIRSDPLQMGGFDIFN
SMLTNKYLSSSPRSIDVQDNRNVEFMAPPPHPPPLHPLDHLRHYDDSSNNMWGFEANSEF
QAFSGVVGPSEPMMSTFGEEDFPFLISNKRNNELSLSLASDVSDECSEISLCAATRLASE
QASCSSKDISNNVVTQGFSQLIFGSKYLHSVQEILSHFAAYSLDYSSRGTESGAASSAFT
SRFENITEFLDGDSNNSEAGFGSTFQRRALEAKKTHLLDLLQMVDDRYSHCVDEIHTVIS
AFHAATELDPQLHTRFALQTVSFLYKNLRERICKKIISMGSVLERGKDKTQETSMFHQHC
LLQQLKRKNHQIWRPQRGLPEKSVSVLRNWMFQNFLHPYPKDSEKHLLAIRSGLTRSQVS
NWFINARVRLWKPMIEEMYAEMNKRKLNNSHIQPNGPTLRMPKSVMMSQAMHK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggacaacaacaacaacaacaacacttttagttctctggataatgtcatgactaaccaa
aatcctcttctcatggattttataccttcaagagaagattcaacttcattctcaacaatg
cttccatggaataccatcagatcagatcctctacaaatgggtggctttgatattttcaat
tctatgctgactaacaaatacttatcatcttctccacggtctatcgatgttcaagataac
cgcaatgttgagttcatggctcctcctcctcatcctcctccacttcatcctttggatcat
ttaagacactatgatgattcctcaaacaacatgtggggttttgaagcaaatagtgagttt
caggcattttcaggtgtagttggtccaagtgaaccaatgatgtctacattcggtgaagaa
gatttcccgtttctaatttcgaataaaagaaacaatgagctttcattgagtcttgcatca
gatgtttctgatgaatgctcggagataagtctttgtgcagctacaagattagcctcagag
caagcttcttgcagcagcaaagacatttctaataacgttgttactcaaggtttctctcaa
cttatatttggctcaaaataccttcactctgttcaagaaatactatctcatttcgccgca
tactcgctcgattattcatctcgaggaaccgagtcaggagctgctagttcagcctttact
tcacgttttgagaatataactgagtttcttgatggtgattctaataactcggaggcgggt
ttcggatctacatttcaaaggagagcattagaagcaaagaaaacccatctcttggatctt
cttcaaatggtggatgatcgatatagtcattgcgtagatgagattcatacggttatatca
gcgttccatgctgcaaccgagttagatccacagttacacacccggtttgccctccaaacc
gtttccttcttatacaagaacctgagagagagaatctgcaagaagataatctctatggga
tctgtattggagagaggcaaagacaagactcaagaaacctctatgttccaccagcattgc
cttcttcagcagctgaaacgaaagaaccatcagatttggagacctcaacgaggtttgcct
gagaaatctgtttcggttctacggaattggatgttccaaaacttccttcacccttacccg
aaagattcggagaaacatcttctagctatacgaagtggcttgacaagaagtcaggtatca
aactggtttataaatgcgcgggttaggctatggaagccgatgatagaagagatgtatgcg
gaaatgaacaagaggaagctcaataacagtcacattcaacccaacggaccaactcttcga
atgccaaaatctgttatgatgagccaagcaatgcataaataa

DBGET integrated database retrieval system