KEGG   Arabidopsis thaliana (thale cress): AT4G33060Help
Entry
AT4G33060         CDS       T00041                                 

Definition
(RefSeq) Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein
  KO
K12737  peptidyl-prolyl cis-trans isomerase SDCCAG10 [EC:5.2.1.8]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ath03041]
    AT4G33060
   03110 Chaperones and folding catalysts [BR:ath03110]
    AT4G33060
Enzymes [BR:ath01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     AT4G33060
Spliceosome [BR:ath03041]
 Complex C
  Other components
   PPlases
    AT4G33060
Chaperones and folding catalysts [BR:ath03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    AT4G33060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase Arteri_nsp7a
Motif
Other DBs
NCBI-GeneID: 829443
NCBI-ProteinID: NP_195032
MIPS: AT4G33060.1
TAIR: AT4G33060
Araport: AT4G33060
UniProt: Q6Q152 A0A178V132
Position
4
AA seq 504 aa AA seqDB search
MSTVYVLEPPTKGKVIVNTTHGPIDVELWPKEAPKSVRNFVQLCLEGYFDNTIFHRVIPG
FLVQGGDPTGSGTGGDSIYGGVFADEFHSRLRFSHRGIVAMANASSPNSNGSQFFFTLDK
CDWLDKKHTIFGKVTGDSIYNLLRLGEVDTSKDDRPLDPAPKILSVEVLWNPFEDIVPRV
LAKTSEESAAEIKEPPTKPVKKLNLLSFGEEAEEEEKELAVVKQKIKSSHDVLNDPRLLK
AEASDKERNASESKEVLSVREALNAKKEAAQKDKSFSVSDTVGNSDDDDDGEDETKFDAK
MRNQVLSRRKEIGDTPSKPTQKKKSSSLKGREESTQRSDAVSSEDEKPRMEKLSLKKKGI
GSEAKAEHMEKGDTDLQLYNASERARQLHKLKKRRLQGNEDSVLAKLEKFKQSISAKPFT
SSNEPVVLTSSSEPVDNKEEDLSDWKNVKLKFAPERGKDKMSRRDDPDAYMVVDPLLEKG
KEKFNRMQAKQKRREREWSGKSLA
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacggtgtacgtgctagagccgccgacaaagggaaaggtcattgtaaatactact
catggtccaatcgacgtcgagctttggcctaaggaagcgcccaaatccgtacggaacttc
gttcaactatgcctcgagggttactttgacaacaccatcttccatcgtgtcattcccggt
tttctcgttcaaggcggcgatcccaccggctccggaaccggtggagatagtatatatgga
ggtgtctttgccgatgagttccattcaaggctgagatttagccaccgtgggattgttgcc
atggctaatgcgagctcacctaattctaatggaagtcagttctttttcactttggataag
tgtgattggcttgataagaagcacactatctttggcaaggtaacgggcgattcaatctac
aatcttttaagactaggagaggttgacacgagtaaggatgatcgacctctggatcctgct
ccgaaaatattatctgtcgaggttttgtggaacccttttgaagatattgttcctagagtg
ttagcaaagacatcagaagaatctgctgctgaaatcaaggaacccccaacaaagcccgtg
aagaaattgaatttactgtcattcggagaagaagctgaagaagaggaaaaggaactggct
gttgtaaagcaaaagattaagagcagtcatgacgtattgaatgatcctcgacttttgaag
gcagaagcttcagataaagagaggaacgcatctgagtccaaggaggtactatctgtgcga
gaagctctgaatgctaagaaagaagcggctcaaaaagataaaagcttttctgtatctgat
acagttggaaatagtgatgatgacgatgatggtgaagatgagactaaatttgatgcaaag
atgaggaatcaagtgctcagcagaaggaaggagattggagatacgccttcaaagccgact
cagaaaaaaaagagctctagcctgaaaggccgtgaagagtctacgcaaaggtctgatgct
gtaagtagtgaagatgagaaaccaaggatggaaaagttgtccttgaagaaaaaaggaata
ggctcagaagccaaagccgaacatatggagaaaggagacactgatttacagctttacaac
gcttctgaacgcgcccggcagttgcataagttgaaaaagcgcagactgcaaggaaatgag
gattctgtgttagcaaaactcgagaagtttaagcagtctatctctgcaaaaccgtttacc
tcgagtaatgaaccagtagtgttgacctcgagtagtgaaccagttgacaataaagaagaa
gatctctctgattggaagaatgtaaagctcaagtttgctcctgagcgtggcaaggataaa
atgtcacgcagggatgatccagatgcgtatatggtggttgaccctcttcttgaaaaggga
aaagagaagttcaacagaatgcaagccaaacaaaaacgaagggagcgagaatggtctgga
aaatctcttgcctga

DBGET integrated database retrieval system