KEGG   Arabidopsis thaliana (thale cress): AT4G33500
Entry
AT4G33500         CDS       T00041                                 
Name
(RefSeq) Protein phosphatase 2C family protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: PP2C PP2C_2 SpoIIE
Other DBs
NCBI-GeneID: 829488
NCBI-ProteinID: NP_567923
TAIR: AT4G33500
UniProt: Q93V88 A0A178UZ81
Position
4:complement(16112624..16116383)
AA seq 724 aa
MADHLILSLQAPPFLIFPCSLHRSWRFPGGIRYSVPEFRLSSQLQLANSISPSKSSASSS
SPPENSAPEKFDLVSSTQLKDGSHVFRFGDASEIEKYLEAEEKARCVEVETQNAKIAEEA
SEVSRKQKKLVSSIIETSTEKEETAAPSDLSNVIKIKDRKRVRSPTKKKKETVNVSRSED
KIDAKSASVSNLSSIVSVAEAIPISSTEEEAVVEKEITAKSYNVEPLSSEAMKKVSVNKI
GDCETNGYQENRMEVQARPSLSTQQEITPVSTIEIDDNLDVTEKPIEAEENLVAEPTATD
DLSPDELLSTSEATHRSVDEIAQKPVIDTSEENLLNTFEAEENPVVEPTATAAVSSDELI
STSEATRHSVDEIAQKPIIDTSEKNPMETFVEPEAVHSSVDESTEKLVVVTSDVENDGEN
VASTTEDEITVRDTITDSGSISNNDDTKVEDLQLPVPETASLEPIKAASGREELVSKAFY
LDSGFASLQSPFKALAGREDAYFISHHNWIGIADGVSQWSFEGINKGMYAQELMSNCEKI
ISNETAKISDPVQVLHRSVNETKSSGSSTALIAHLDNNELHIANIGDSGFMVIRDGTVLQ
NSSPMFHHFCFPLHITQGCDVLKLAEVYHVNLEEGDVVIAATDGLFDNLYEKEIVSIVCG
SLKQSLEPQKIAELVAAKAQEVGRSKTERTPFADAAKEEGYNGHKGGKLDAVTVIISFVK
IVST
NT seq 2175 nt   +upstreamnt  +downstreamnt
atggccgatcatttgattctttctcttcaagctcctccttttctcatcttcccttgttct
cttcaccgttcatggagatttcccggtggaatcagatattccgttcctgagttccgattg
tcctctcagctacagttggctaattccatttcaccttcaaagtcttcagcttcctcttct
tctccaccggagaattctgctccagagaagttcgatctcgtgtccagcactcagcttaaa
gatggaagtcatgtctttcggttcggggatgcaagtgagattgagaaatatctcgaggct
gaagaaaaagcgagatgtgttgaggtagaaacgcaaaatgctaagattgctgaagaagcc
agtgaagtttcaaggaaacaaaagaaattggtcagttctattattgaaacaagtactgag
aaagaggaaacagctgctccttccgatcttagcaatgtcattaaaataaaggatcgtaaa
agggttcgttctcctactaagaagaagaaagaaactgtgaatgtatcacggagcgaagat
aaaattgatgccaagagtgctagtgtttccaatctgagctccatagttagtgtagcagaa
gctattccaattagctctactgaagaagaagctgttgttgagaaggaaatcacggctaag
tcatataatgtagagcctctttcttctgaagccatgaagaaagtttctgtcaataaaata
ggagactgtgagacaaatggttatcaagagaatcgtatggaggttcaggcaagaccgtca
ttgtctacacaacaggaaattacgcctgtatccaccattgaaattgatgacaatttggat
gtgacggaaaagcctattgaagctgaggagaatcttgtcgcggaaccaacagctacagat
gatttgtctcctgatgaactcctttcaacttcagaagcaacacatcgcagcgttgatgag
attgctcaaaaacctgtaattgatacgtctgaggaaaaccttctgaacacttttgaagct
gaggagaatcctgtagttgaaccaacagctacagctgctgtctcttctgatgaactcatt
tcaacttcagaagcaacacgtcacagcgttgatgagatcgctcaaaagcctattattgat
acgtctgagaaaaaccctatggaaacttttgttgaaccagaagcagtgcatagtagcgtt
gacgagagcactgaaaagcttgtagttgttacgtctgatgtggaaaatgatggagaaaat
gtagcttcaaccacagaagatgaaataactgtgagggacacaataactgatagtggtagc
atatccaataatgatgacacaaaagtggaagatctccaacttcctgtacctgaaacggcc
agtcttgaacccattaaagcggcttctggcagggaagaacttgtgtccaaagcattttac
ttggactctggttttgcttcactccaaagcccctttaaggcattggcaggtcgggaagat
gcttattttatctctcaccacaattggataggtattgctgatggagtctctcagtggtca
tttgaaggaatcaataagggaatgtatgctcaagaactcatgagcaactgtgaaaagatt
atttccaatgaaactgctaagataagtgacccagttcaagttctccatagaagtgtcaat
gagactaagtcctctggatcatcaacagccttaattgctcatcttgacaataatgaactc
cacatagccaatattggagattcgggattcatggtcattagggatggcacagtattgcag
aattcgtctccaatgtttcatcatttttgttttcccttgcatattacgcaaggctgtgat
gtcctaaaacttgcagaggtttaccatgtgaacctggaagaaggcgatgttgtcatcgca
gcaactgatgggctctttgataacttatacgaaaaagaaatcgtttcaatagtttgcggg
tcactgaaacagagtctggaacctcagaaaatagcagagttggtagctgcaaaagcacaa
gaagtaggacgatctaagacagagagaacgccatttgctgacgcagctaaagaagaagga
tacaatggacacaaaggtggtaaacttgatgctgttaccgtcatcatttcattcgtgaaa
attgtctctacataa

DBGET integrated database retrieval system