KEGG   Arabidopsis thaliana (thale cress): AT4G33700Help
Entry
AT4G33700         CDS       T00041                                 

Definition
(RefSeq) CBS domain protein (DUF21)
  KO
K16302  metal transporter CNNM
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT4G33700
Transporters [BR:ath02000]
 Other transporters
  Others
   AT4G33700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF21 CBS
Motif
Other DBs
NCBI-GeneID: 829512
NCBI-ProteinID: NP_195096
MIPS: AT4G33700.1
TAIR: AT4G33700
Araport: AT4G33700
UniProt: Q8VZI2 A0A178V5M0
Position
4
AA seq 424 aa AA seqDB search
MAVEYVCCSPNFFIHIAVIVFLVLFAGLMSGLTLGLMSLSLVDLEVLAKSGTPEHRKYAA
KILPVVKNQHLLLVTLLICNAAAMETLPIFLDGLVTAWGAILISVTLILLFGEIIPQSIC
SRYGLAIGATVAPFVRVLVFICLPVAWPISKLLDFLLGHRRAALFRRAELKTLVDFHGNE
AGKGGELTHDETTIIAGALELSEKMVKDAMTPISDIFVIDINAKLDRDLMNLILEKGHSR
VPVYYEQPTNIIGLVLVKNLLTINPDEEIPVKNVTIRRIPRVPEILPLYDILNEFQKGLS
HMAVVVRQCDKIHPLPSKNGSVKEARVDVDSEGTPTPQERMLRTKRSLQKWKSFPNRASS
FKGGSKSKKWSKDNDADILQLNGNPLPKLAEEEEAVGIITMEDVIEELLQEEIFDETDHH
FEDS
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggagtatgtatgttgcagcccaaacttctttatacatatagctgtgattgtg
tttcttgtcttgttcgctggactcatgtctggcttaacattgggtcttatgtctttgagt
ctcgttgatcttgaagttctcgctaaatccggtacacctgaacatcgtaaatatgcagca
aagatattgccagtggtaaagaatcagcacttgttgcttgtcactttacttatatgcaat
gcagctgctatggagacgcttcctatttttcttgatggccttgtgacggcatggggtgcc
attttgatttcagttacattgattcttctctttggtgagattatacctcagtcgatttgt
tcacgttatggtttagcgattggtgcaacagtggctccgtttgtccgtgtcctagtcttt
atctgcttacctgttgcatggccaataagcaagttgctggactttctattgggtcatcgt
cgtgcagcgctttttcgaagagctgagctgaaaacacttgtggattttcatggaaatgag
gctggaaagggtggggagttgactcatgacgaaacgacaatcattgcaggagctcttgaa
ctctctgagaaaatggtcaaagatgcaatgacaccaatatcggatatctttgtgattgat
atcaatgccaaactagacagagacttgatgaacttgattcttgagaaagggcatagcaga
gttccagtatactatgagcagccaactaacataatcggccttgttctggtgaagaactta
ttaactatcaacccagatgaagaaatacctgtcaagaatgtcacgataagaaggattcca
agagttccagaaatcttgcctttatatgacatattgaacgaattccagaaaggactcagc
cacatggctgttgttgtaagacagtgtgacaaaatccacccattaccttctaaaaatggg
agtgttaaggaagcccgagtggatgtggatagtgagggaactcctactcctcaggagaga
atgttaaggacaaaaagatcgcttcaaaagtggaagagctttccgaatcgagcaagttcg
tttaaaggagggtcaaagagcaagaagtggtcaaaagacaatgatgcagacatcctgcaa
ttgaatggcaatccgctgcctaaacttgctgaggaagaagaagcagtcggaatcattacg
atggaggatgtcattgaagaacttctgcaggaggagatctttgacgaaactgatcaccat
tttgaagactcctaa

DBGET integrated database retrieval system