KEGG   Arabidopsis thaliana (thale cress): AT4G33910Help
Entry
AT4G33910         CDS       T00041                                 

Definition
(RefSeq) 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein
  KO
K00472  prolyl 4-hydroxylase [EC:1.14.11.2]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00330  Arginine and proline metabolism
ath01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    AT4G33910
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.2  procollagen-proline 4-dioxygenase
     AT4G33910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2OG-FeII_Oxy_3 2OG-FeII_Oxy
Motif
Other DBs
NCBI-GeneID: 829535
NCBI-ProteinID: NP_567941
MIPS: AT4G33910.1
TAIR: AT4G33910
Araport: AT4G33910
UniProt: Q8VZJ7
Position
4
AA seq 288 aa AA seqDB search
MKSRLKSYRRKKLGLATVIVFCSLCFLFGFYGSTLLSQNVPRVKPRLRMLDMVENGEEEA
SSMPHGVTGEESIGSIPFQVLSWRPRAIYFPNFATAEQCQAIIERAKVNLKPSALALRKG
ETAENTKGTRTSSGTFISASEESTGALDFVERKIARATMIPRSHGESFNILRYELGQKYD
SHYDVFNPTEYGPQSSQRIASFLLYLSDVEEGGETMFPFENGSNMGIGYDYKQCIGLKVK
PRKGDGLLFYSVFPNGTIDQTSLHGSCPVTKGEKWVATKWIRDQDQEE
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcagattgaagagctacaggaggaagaagctagggttagccacagttatcgtc
ttctgttctctctgtttcctcttcggtttctatggctccactctactttctcagaatgtg
cctcgtgttaaacccaggttgagaatgttggatatggttgagaatggggaagaagaagct
agctcgatgcctcatggtgttactggagaagaatctattggatcgattccttttcaggta
cttagttggagacctagggctatatattttccgaattttgcaactgcagaacaatgccaa
gctattattgagagagcaaaggttaatctgaaaccttctgctttggctctccggaaagga
gaaactgctgagaacactaagggcactagaacaagctcaggaacttttatcagtgcttca
gaagagagtactggtgctctggattttgttgaaaggaaaatcgcaagagctacgatgatc
ccaaggtcccatggagagtcattcaatattttacggtatgaacttggccaaaagtatgat
tcccactatgatgttttcaacccaacagaatatggaccacaatcaagccaaaggattgcc
tccttcctgttgtacttatctgatgttgaagaaggcggtgaaaccatgttcccatttgag
aacggttctaatatgggcatcggatacgattacaagcaatgtattgggttgaaagtaaag
cctcggaaaggagatggtcttcttttttattccgtgtttccaaatggaacgattgatcag
acttcgcttcacgggagctgcccggtgaccaaaggagagaaatgggtggcaaccaaatgg
atcagagaccaagaccaggaagaataa

DBGET integrated database retrieval system