KEGG   Arabidopsis thaliana (thale cress): AT4G33920Help
Entry
AT4G33920         CDS       T00041                                 

Definition
(RefSeq) Protein phosphatase 2C family protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: PP2C PP2C_2 SpoIIE
Motif
Other DBs
NCBI-GeneID: 829536
NCBI-ProteinID: NP_195118
MIPS: AT4G33920.1
TAIR: AT4G33920
Araport: AT4G33920
UniProt: O81760 A0A178US28
Position
4
AA seq 380 aa AA seqDB search
MLRALARPLERCLGSRASGDGLLWQSELRPHAGGDYSIAVVQANSRLEDQSQVFTSSSAT
YVGVYDGHGGPEASRFVNRHLFPYMHKFAREHGGLSVDVIKKAFKETEEEFCGMVKRSLP
MKPQMATVGSCCLVGAISNDTLYVANLGDSRAVLGSVVSGVDSNKGAVAERLSTDHNVAV
EEVRKEVKALNPDDSQIVLYTRGVWRIKGIIQVSRSIGDVYLKKPEYYRDPIFQRHGNPI
PLRRPAMTAEPSIIVRKLKPQDLFLIFASDGLWEHLSDETAVEIVLKHPRTGIARRLVRA
ALEEAAKKREMRYGDIKKIAKGIRRHFHDDISVIVVYLDQNKTSSSNSKLVKQGGITAPP
DIYSLHSDEAEQRRLLNVLY
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgagctttagcacggcctctcgaacggtgtttgggaagcagagctagtggtgat
ggtttactctggcaatcggaattgagacctcacgctggcggtgattattcgatcgcggtg
gttcaagccaattccaggcttgaagatcagagtcaggttttcacatcttcttctgctact
tacgtcggtgtatacgatggtcatggtggacctgaagcttctagattcgttaacagacat
ctctttccttatatgcacaaatttgcaagagaacatgggggattatctgtagatgttatc
aaaaaggcattcaaagaaacagaagaagagttttgtggtatggttaaacgatcccttccc
atgaaaccgcaaatggctactgtaggatcttgctgtcttgttggtgcaatctctaatgac
acactgtatgttgctaatcttggggactcgagagccgttcttggaagcgttgtttcaggg
gttgatagtaataaaggtgccgtagctgaacggttatctactgatcataatgttgctgtt
gaagaagtgagaaaggaggttaaggcacttaaccctgatgactcacaaatcgtcttatac
acacgtggagtttggcggattaaaggcattattcaggtatcgagatcaattggggatgta
tacttgaaaaaaccggagtattacagggacccgattttccagcgacatggaaatcccatt
cctttgaggagacccgcgatgacagccgaaccctccattatagtaaggaagcttaagcca
caggacttgtttctgatatttgcatcagatggtctctgggaacatcttagtgatgaaaca
gccgtagaaatcgtcctcaaacacccaagaactggtattgcccgaagacttgtaagagct
gctctggaagaagcggcaaagaagagagaaatgagatatggagatataaagaaaatagcc
aaaggaattcgacgacatttccatgacgacataagcgttattgtagtttatctagatcaa
aacaaaaccagttcatcgaatagtaaattggtgaagcaaggaggtatcaccgctccaccg
gatatctactcattacactctgatgaagcagagcaacgacggttactcaatgtgttatac
tga

DBGET integrated database retrieval system