KEGG   Arabidopsis thaliana (thale cress): AT4G33970
Entry
AT4G33970         CDS       T00041                                 
Name
(RefSeq) Leucine-rich repeat (LRR) family protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: LRR_8 LRR_4
Other DBs
NCBI-GeneID: 829543
NCBI-ProteinID: NP_195123
TAIR: AT4G33970
UniProt: O81765
Position
4:complement(16278941..16282048)
AA seq 699 aa
MPFYKQPWVFSKVFVLAMAKPPSFGCCFFLLFFSFLSSSFVSFALTDTEAAFIVQRQLLT
LPDNGELPDDIEYEVDLKATFANTRLKRAYIALQAWKKAIFSDPFNTTGNWHGPHVCGYT
GVVCAPALDDSDVTVVAGVDLNGADIAGHLPAELGLMTDVAMFHLNSNRFCGIIPKSFEK
LKLMHEFDVSNNRFVGPFPNVVLSWPDVKYFDLRFNDFEGQVPPELFKKELDAIFLNDNR
FTSVIPESLGESPASVVTFANNKFTGCIPKSIGNMKNLNEIVFMDNDLGGCFPSEIGKLS
NVTVFDASKNSFIGRLPTSFVGLTSVEEIDISGNKLTGLVPHNICQLPNLVNLTYSYNYF
SGQGGSCVPGGSRKEIALDDTRNCLASRPEQRSAQECAVVINRPVDCSKDKCAGGSSTPS
KPSPVHKPTPVPTTPVHKPTPVPTTPVQKPSPVPTTPVQKPSPVPTTPVHEPSPVLATPV
DKPSPVPSRPVQKPQPPKESPQPDDPYDQSPVTKRRSPPPAPVNSPPPPVYSPPPPPPPV
HSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPA
PVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPPKINSPPVQSPPPAPV
EKKETPPAHAPAPSDDEFIIPPFIGHQYASPPPPMFAGY
NT seq 2100 nt   +upstreamnt  +downstreamnt
atgcccttctataagcagccttgggtcttttccaaggtttttgttttagccatggctaaa
cctccgtcctttggctgctgcttcttcctcttattcttctccttcttatcttcttccttt
gtctcatttgccctaaccgatacagaagctgccttcattgtgcagcgacaacttttaacg
ttaccagacaacggcgaacttcctgatgatatcgaatacgaggttgatctcaaggctacc
tttgccaacaccaggcttaagagagcttatatagctcttcaggcttggaaaaaggccata
ttttcagacccatttaacaccacggggaactggcatggcccacacgtgtgcggctacacc
ggtgtggtttgtgcgccagctcttgatgattccgatgtcacggttgtagctggtgttgac
ctcaacggtgcggatatcgcagggcatttgcctgctgagcttggtttgatgacagatgtt
gcaatgttccatttgaattcaaaccggttttgtgggatcatacctaaaagctttgagaag
ctaaagctaatgcacgaattcgatgttagtaacaaccgtttcgttggacctttccctaac
gtcgttctctcttggcctgatgtcaaatacttcgaccttaggttcaacgatttcgaaggt
caagtccctcctgagcttttcaagaaagaacttgacgccattttcttgaacgacaataga
ttcacctcggtgattcctgaatctctaggggaatctccggcctcggttgtgacttttgct
aacaataaattcaccggatgtatccctaagagtatcggaaacatgaagaatctcaacgag
attgtctttatggacaatgatttaggaggttgtttcccatctgaaatcggaaagttatcg
aatgtaacggttttcgatgcaagcaagaactcgttcataggtcgtctcccgactagcttt
gtcgggttaacgagcgtggaggaaattgatatctccgggaacaaactcaccggacttgta
ccgcataacatttgccagttgcctaatttggtgaacttgacttattcttacaattacttc
agtggacaaggaggttcttgtgttccaggtggtagtcgcaaggagattgcgttggatgac
acacgcaattgcttggcttctcgacctgagcaacgatccgcccaagaatgtgcggttgtg
atcaaccgcccggttgattgtagcaaggacaagtgcgctggtggctcttctactccatcg
aaaccatcaccggttcacaaaccaacgccagttccaactacgccggttcacaaaccaaca
ccagttccaactacgccggttcaaaaaccatcgccagttccaactacaccggttcaaaaa
ccatcgccagttccaacaacccctgttcacgaaccatcgccagttttagctacgccggtt
gacaaaccatcgccagttccatctcggccggttcaaaaaccacaaccaccaaaagagtca
cctcaaccagatgatccttacgatcaatctccagtgacgaaaaggcgcagccctcctccg
gctccggtcaactctccaccaccaccagtttactccccaccacctcctcctccacccgtt
cactctcccccgccgccagtccactctcctccaccaccaccggtgtattcgcctccgccc
ccacccccacctgtccactctcctccaccgcctgtcttttcaccaccacctccagtctat
tccccgcctcccccagtccactcaccgcctcccccagtccattcgccgccgccgccagca
cctgttcactcaccgcctccaccggttcattcccccccgccaccaccacctgtttattca
ccgccaccaccggtcttttctccaccgccgtcgcaatctccaccagtagtctactctcct
ccgccaagaccgcccaagatcaactccccaccagtccaatcaccaccgccagcaccggtg
gaaaagaaagagacccctccggctcatgcaccagctccaagtgacgatgaattcatcata
ccaccgttcatcggccaccaatacgcatcaccaccaccgccaatgttcgcaggctactaa

DBGET integrated database retrieval system