KEGG   Arabidopsis thaliana (thale cress): AT4G34590Help
Entry
AT4G34590         CDS       T00041                                 

Gene name
GBF6
Definition
(RefSeq) G-box binding factor 6
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 BioW SR-25 HAUS5 Cep57_CLD_2 Nup54_57_C bZIP_Maf DUF4140 YabA
Motif
Other DBs
NCBI-GeneID: 829611
NCBI-ProteinID: NP_195185
MIPS: AT4G34590.1
TAIR: AT4G34590
Araport: AT4G34590
UniProt: O65683 A0A178UVA0
Position
4
AA seq 159 aa AA seqDB search
MESSSSGTTSSTIQTSSGSEESLMEQRKRKRMLSNRESARRSRMKKQKLLDDLTAQVNHL
KKENTEIVTSVSITTQHYLTVEAENSVLRAQLDELNHRLQSLNDIIEFLDSSNNNNNNNM
GMCSNPLVGLECDDFFVNQMNMSYIMNQPLMASSDALMY
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgtcgtcgtcgggaacaacttcgtcgacgattcaaacgtcgtcaggatcggag
gagagtctcatggagcagaggaaacgtaaacggatgctctcaaaccgtgaatctgcaagg
agatcaagaatgaagaaacaaaagctcctagacgatctaacggctcaggttaatcatctg
aaaaaagagaacacggagatcgtgacaagtgtcagcatcacaacgcaacactacctaacc
gttgaagcagagaactctgttctcagagctcagcttgatgaacttaaccacaggctccaa
tctctcaacgacatcatcgagttcctcgacagtagcaacaacaacaacaacaacaacatg
ggcatgtgttcgaaccctctggttggtttggagtgtgatgatttcttcgtgaatcagatg
aacatgtcttatattatgaaccagcctctcatggcgtcttctgatgctttaatgtattaa

DBGET integrated database retrieval system