KEGG   Arabidopsis thaliana (thale cress): AT4G34610Help
Entry
AT4G34610         CDS       T00041                                 

Gene name
BLH6
Definition
(RefSeq) BEL1-like homeodomain 6
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: POX Homeobox_KN Homeodomain DUF444 OmpH Unpaired MscS_porin Homez CCDC53
Motif
Other DBs
NCBI-GeneID: 829613
NCBI-ProteinID: NP_001119116
MIPS: AT4G34610.1
TAIR: AT4G34610
Araport: AT4G34610
UniProt: O65685
Position
4
AA seq 532 aa AA seqDB search
MENYPETQFIPGDSMIQNAIVSYSEESAGRERRTEANNVSASQERQALSRFGGVPQMQNI
GQDFGSWRDQASDRNGFQLMSAMAGATGILQTGQGLSLSLGSQILPGIHQISHQNMAPRG
NEYATQSFPGGNQNLDVVRTIPNSKYLKAAQQLLDEAVNVKKALKQFQAEGDKNNENPQE
PNQSTQDSSTNPPADISQSERQEMQSKLTKLLSMLDEVDRRYKQYYQQMQIVVSSFDVIA
GYGAAKPYTALALQTISRHFRSLRDAISGQILVLRKCLGEQQDGSDGKRVGIISRLKYVD
QHLRQQRGFMQPQAWRPQRGLPENSVLILRAWLFEHFLHPYPKDSDKIMLARQTGLSRGQ
VSNWFINARVRLWKPMVEEIYKEEFTENDSNSSSENTPKMSEIGPVAADDEDRAREFSQD
QTKPDHGHGYGEETRGMVQGSHMDGRRFMAVEPTYHVADTSRLGRGDVSLTLGLQNSQGQ
DNVVAMSSEAYNNFSGVDIYENAIPGDEMEYVNPGSRQNRINSSQLVHDFVA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggagaattatccagaaacacagtttattcccggagattcaatgatccagaatgctata
gtttcttactctgaggaatcagccggtagagaaagaagaactgaagctaacaatgtctca
gcctcacaagagaggcaagcattgtccagatttgggggagttccacaaatgcagaacatt
ggtcaagatttcggttcttggagagatcaagcgagtgacaggaacggtttccagctaatg
agcgcgatggcaggtgccacggggattcttcagaccggtcagggactgtcccttagcctt
ggttcacagattcttccaggaattcatcagataagccatcaaaatatggcgccgagaggc
aatgagtatgcaacacagagttttccgggcgggaatcagaacttggatgttgtgagaaca
attcccaactcaaagtatcttaaggcggctcaacagcttctagatgaggctgttaatgta
aagaaagctctaaagcagtttcaggcagagggagataaaaacaatgagaaccctcaagaa
ccgaatcagagcactcaagactcgagcacgaatcctcctgcggacatctctcagtcggag
agacaagaaatgcagagcaagttgacaaaactcttgtcaatgttggatgaggtggataga
agatataagcaatattaccagcagatgcagatagttgtatcctcgttcgatgtgatagct
ggttatggagcagctaagccatacacagcactcgcccttcaaacaatttctcgccatttt
cgtagcctaagggatgcgatatccggacaaatcctcgtgctacgtaaatgccttggggaa
caacaagatggatcagatgggaaaagagttgggattataagccggcttaagtacgttgat
caacatttaagacaacaaagaggttttatgcaacctcaagcttggagacctcaacgcggt
ctacctgaaaactctgttttgattctccgtgcttggctctttgagcattttcttcaccct
tacccaaaggattctgataagatcatgctagcaagacaaacgggcttgagccgcggtcag
gtttcaaactggttcataaatgcacgagtgcgtttatggaagccaatggtggaggagata
tacaaggaggaattcacagagaatgattccaactcgtcttccgaaaatacaccgaaaatg
tctgagataggacctgttgctgctgatgatgaagatcgagctcgagagttttcacaagac
cagaccaaaccggaccatggacatggatatggcgaggaaactcgtggcatggtccaaggc
agtcatatggatggtcgccggttcatggcagttgagcctacatatcatgtggctgatacg
tcaagattgggtcgtggtgatgtgtccttgactctagggcttcaaaactctcaaggacag
gacaatgttgtggctatgtctagtgaggcatacaacaacttttccggggtggatatttac
gagaatgccatcccgggagatgaaatggagtatgtaaaccccggaagtcgccagaaccgg
ataaattcttcacaattggtacatgattttgtagcttga

DBGET integrated database retrieval system