KEGG   Arabidopsis thaliana (thale cress): AT4G34620
Entry
AT4G34620         CDS       T00041                                 
Symbol
SSR16
Name
(RefSeq) small subunit ribosomal protein 16
  KO
K02959  small subunit ribosomal protein S16
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AT4G34620 (SSR16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ath03011]
    AT4G34620 (SSR16)
Ribosome [BR:ath03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    AT4G34620 (SSR16)
  Bacteria
    AT4G34620 (SSR16)
SSDB
Motif
Pfam: Ribosomal_S16
Other DBs
NCBI-GeneID: 829614
NCBI-ProteinID: NP_195188
TAIR: AT4G34620
UniProt: O65686 A0A178UZA3
Position
4:complement(16534855..16536224)
AA seq 113 aa
MTVKIRLARLGCKHRPFYRVVVADEKSRRDGKQIEVLGFYDPLQGKEDADRVSLKFDRIK
YWLSVGAQPTDTVESMLFRAGLIPPKPMVVVGSKNGQKSTSQHVSPITGEILN
NT seq 342 nt   +upstreamnt  +downstreamnt
atgacggtgaagataaggctcgcgcgtcttggttgtaaacaccgacccttctatcgtgta
gttgtcgccgatgaaaaatcgcgcagggacggtaaacaaatcgaggtgttaggcttttat
gatccactccaaggcaaagaagatgcggatagagtgagcctcaaattcgacagaatcaag
tactggttatctgttggagctcaaccaacagacacagtggaaagcatgcttttcagggcc
ggtttgataccaccaaagcctatggtagtggtcggttcgaaaaatgggcagaagtctacg
agccaacatgtttcacccattacaggtgaaatcttgaactaa

DBGET integrated database retrieval system