KEGG   Arabidopsis thaliana (thale cress): AT4G34880Help
Entry
AT4G34880         CDS       T00041                                 

Definition
(RefSeq) Amidase family protein
  KO
K01426  amidase [EC:3.5.1.4]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00330  Arginine and proline metabolism
ath00360  Phenylalanine metabolism
ath00380  Tryptophan metabolism
ath01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    AT4G34880
   00360 Phenylalanine metabolism
    AT4G34880
   00380 Tryptophan metabolism
    AT4G34880
Enzymes [BR:ath01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     AT4G34880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase DFF-C
Motif
Other DBs
NCBI-GeneID: 829640
NCBI-ProteinID: NP_001329257
MIPS: AT4G34880.1
TAIR: AT4G34880
Araport: AT4G34880
UniProt: A0A1P8B760
Position
4
AA seq 512 aa AA seqDB search
MVALRFFFFSSLLILLILSQALIMSVGSASQIRLSSTFSIQEATIEDIRVAFNEKRLTSK
QLVELYLEAISKLNPILHAVIETNPDALIQAEIADRERDLKNTTKLPILHGVPVLLKDSI
STKDKLNTTAGSFALLGSVVARDAGVVKRLRESGAVILGKASLSEWAHFRSFSIPDGWSA
RGLQGKNPYVLSANPSGSSSGSAISVTANLVAVSLGTETDGSILSPASQNSVVGIKPSVG
LTSRAGVVPISLRQDSIGPICRTVSDAVHLLDAIVGYDPLDEATKTASEFIPEGGYKQFL
TTSGLKGKRLGIVMKHSSLLDHHIKTLRREGAIVINNLTIPNIEVIVGGTDSGEEIALLA
EFKMSLNAYLKELVKSPVRSLADVIAYNEEFAEQEKVKEWGQEVFLTAEATSGMGEKEKT
ALQKMKELSRNGIEKLIEENKLDAIVTLGSDLSSVLAIGGYPGINVPAGYDSGGVPYGIS
FGGLRFSEPKLIEIAFAFEQATLIRKPPKFIA
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggttgctctgcgtttcttcttcttctcatctcttcttattcttcttattctttctcaa
gctcttattatgtcagttggatctgcctctcagatcaggcttagctcaacgttctcgatc
caagaagctaccattgaagacattagagttgctttcaacgagaaacgactaacatcaaag
cagcttgtggagttgtatctcgaagcaatctccaaacttaatccaatactccacgcagtc
atcgagacgaatcctgatgcgttgatccaagcagagatcgcagacagagaacgtgacctt
aaaaacaccactaagcttcctatcttgcacggtgttccggttcttctcaaggattccata
tctaccaaggacaagcttaacaccacggctggctcgtttgccttgcttggttcggtcgtg
gctcgagacgcgggtgttgttaaaagactgagagaatctggtgctgtgatcttgggcaaa
gccagtttaagtgaatgggctcattttcgatctttctccatcccagatggttggagcgca
cgtggcctccaaggaaagaatccatatgttttatcagcaaatccgtctgggtcaagtagt
ggatcagctatatctgtaacagccaatcttgtggcagtgtcactagggactgaaactgat
ggttccattctgtctccagcaagtcagaactctgtggtcgggattaaaccgagtgtcgga
ctcacgagccgagccggggtagttcctatctccttgagacaggacagtattgggccgatt
tgtaggacagtgtcggatgctgttcatctccttgatgctattgtgggttatgatccattg
gacgaggccacgaaaactgcgtccgagttcatacctgaaggcggttacaagcagtttctg
acaactagtggcctcaaaggtaagagattagggattgtaatgaagcattcttctcttctt
gatcatcacatcaaaacattaagacgagaaggcgctattgtcattaacaatctgacgata
ccaaacatcgaagtcattgtgggtgggactgatagtggtgaagagatagcacttttggct
gagttcaagatgtctctcaatgcatatcttaaagagcttgtgaaatcaccagtccggtcc
ttagcagatgttattgcctacaacgaggaattcgctgaacaagaaaaagtgaaagaatgg
ggacaagaggtgttccttacagcagaagccactagtggaatgggtgagaaagagaaaaca
gcgttgcagaaaatgaaagaactatcgaggaatggaatcgaaaagctaattgaagagaac
aagttagatgcaatagtgacacttggttcagatttgagctctgtcctagccattggaggg
tatccaggaatcaatgtccctgcaggatacgatagtggaggagttccatatgggattagc
tttggaggactgagattctcagagccaaagctcattgagattgcttttgcctttgaacaa
gcaactcttattagaaagccacccaagttcatagcttga

DBGET integrated database retrieval system