KEGG   Arabidopsis thaliana (thale cress): AT4G35090
Entry
AT4G35090         CDS       T00041                                 
Symbol
CAT2
Name
(RefSeq) catalase 2
  KO
K03781  catalase [EC:1.11.1.6]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00380  Tryptophan metabolism
ath00630  Glyoxylate and dicarboxylate metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
ath04016  MAPK signaling pathway - plant
ath04146  Peroxisome
Module
ath_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AT4G35090 (CAT2)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    AT4G35090 (CAT2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    AT4G35090 (CAT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT4G35090 (CAT2)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     AT4G35090 (CAT2)
SSDB
Motif
Pfam: Catalase Catalase-rel
Other DBs
NCBI-GeneID: 829661
NCBI-ProteinID: NP_195235
TAIR: AT4G35090
UniProt: P25819 A0A5S9XYQ5
Position
4:complement(16700312..16703504)
AA seq 492 aa
MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP
ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLINKAGKAHYVKFHWKPTCGVKSLLEEDA
IRVGGTNHSHATQDLYDSIAAGNYPEWKLFIQIIDPADEDKFDFDPLDVTKTWPEDILPL
QPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNY
LQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERC
IIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQ
KLASRLNVRPSI
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggatccttacaagtatcgtccagctagttcttacaactctcccttcttcaccaccaac
tctggtgctcctgtatggaacaacaactcctccatgaccgttggacccagaggtcctatc
cttcttgaggattaccatctcgttgagaagcttgccaatttcgacagggaacggattcca
gagcgtgtggttcatgccagaggagccagtgctaaaggtttctttgaggtcactcatgat
atctctaacctcacttgtgctgactttctccgagctcccggtgttcagactcctgtcatt
gtccggttctccaccgttatccatgagcgtggaagtcccgagaccttgagagaccctcgt
ggttttgcagtcaagttctacaccagagaggggaactttgatcttgttggaaacaacttt
cctgttttcttcatccgcgatgggatgaagttccctgacatggtccacgctcttaagccg
aacccaaaatctcacatccaagagaactggagaatccttgacttcttctcccaccaccct
gaaagtttgaacatgttcactttcctcttcgatgatatcggtatcccacaagattacagg
cacatggatggttcaggtgtcaatacatacatgttgatcaacaaagctggcaaagctcac
tacgtgaagttccattggaaaccaacttgtggagtcaagtctcttttggaagaagatgca
attcgtgttggaggaaccaaccacagtcatgcgactcaagacttgtatgactctatagct
gctggaaactaccctgaatggaagctctttatccaaatcattgatcctgctgatgaagac
aagttcgactttgacccgctcgatgtgaccaagacctggcctgaggatatcttgcctctt
caacctgttggacgtatggtgttgaacaagaacattgacaacttctttgcagagaatgag
caacttgctttctgtcctgcaattattgtcccagggatacattactcagatgataagctg
cttcaaacccgtgtcttctcctatgccgatactcagagacaccgtcttggaccaaactac
cttcagctgccagtcaatgctccaaaatgtgctcaccacaacaaccaccatgagggattc
atgaatttcatgcacagggacgaggaggttaactacttcccgtcgaggtatgaccaggtt
cgtcatgctgagaagtatccaactccgcctgctgtctgttctggaaaacgtgagaggtgc
attattgagaaagagaacaacttcaaggagcctggagagagataccgtacctttacacca
gagaggcaagaacgattcatccagagatggattgatgccctatccgacccacgcatcacg
catgaaatccgcagtatctggatctcttactggtctcaggctgataagtctttgggacag
aagctggcaagccgtctgaacgtgagaccaagcatctaa

DBGET integrated database retrieval system