KEGG   Arabidopsis thaliana (thale cress): AT4G36210
Entry
AT4G36210         CDS       T00041                                 
Name
(RefSeq) transmembrane/coiled-coil protein (DUF726)
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: DUF726 DUF900 Abhydrolase_6 Cutinase PE-PPE Abhydrolase_1
Other DBs
NCBI-GeneID: 829778
NCBI-ProteinID: NP_001078500
TAIR: AT4G36210
UniProt: B3H797
Position
4:17130246..17134656
AA seq 672 aa
MVEATSNLTPTQRYAAGALFAIALNQAQINQTQPLGTPAAEDDDGGDEERRSNCSSGDSV
SDDPSLWVHETSGLLRPVFRCLEIDSPAWLGLEQTACSSPAKHHIGAFTRLLSEEANDAS
AEMVEQEMALAKAADAMVHSIQCSVSIDAKKEKHQEYENECREKYAVPEVKSKDVDLDKE
KDKKEAAESAAREGLEAGVVIIDGSHKPEVLENEKSVEEVTLLSHQRKINVLYELLSACL
SDKHHEDKKCKRCRKGYDARHRVALRLLATWFNIEWIKVEAIETMVACSAMAIQKSAEMK
GEDNLTPTTSWAKWKRGGIIGAAAITGGTLMAITGGLAAPAIAAGFGALAPTLGTIIPVI
GAGGFAAAASAAGTVAGSVAVAASFGAAGAGLTGTKMARRIGDLDEFEFKAIGENHNQGR
LAVEVLVAGVVFEEEDFVKPWEGLTSNLERYTLQWESKNLILVSTAIQDWLTSRLAMELM
KQGAMHTVLASLLMALAWPATILVAADFIDSKWSIAIDRSDKAGRLLAEVLQKGLQGNRP
ITLVGFSLGARVIFKCLQALAETEQNAELVERVVLLGAPISINSENWRDVRKMVAGRFIN
VYATNDWTLGIAFRASLISQGLAGIQPICIPGIENVDVTDMVEGHSSYLWKTQQILERLE
IDTYYPVFRDTL
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggtggaagctacgtcgaatttgacgccgactcagagatatgcggccggcgcattgttt
gcgatcgctttgaaccaagcgcaaatcaaccagactcagccgctgggaaccccggcggcg
gaagacgacgacggaggcgatgaagagcgaagaagcaattgcagtagcggagattctgtc
tccgatgaccccagcctttgggtacacgagacgtctggccttcttcgccccgttttcaga
tgtcttgagattgattcaccggcttggcttggtctcgagcaaacagcttgctcttctccg
gctaagcaccacatcggggcgttcacgaggttactctcagaagaagcgaatgatgcttct
gccgagatggtggagcaagagatggccttagctaaagctgctgatgctatggtgcatagc
attcaatgctctgtatctatagatgctaagaaggagaagcatcaagaatacgaaaacgaa
tgccgtgagaaatatgctgttcctgaggtaaaatcaaaagatgttgatttggataaagag
aaggataagaaggaagcggctgaaagtgctgcaagagaaggtcttgaagcgggtgtggtt
attatagatggaagccacaagcctgaagttcttgaaaatgagaagtctgttgaggaagta
acattgcttagtcatcagaggaagataaatgttctttatgagctactttctgcttgcttg
tcagataaacatcacgaggataagaaatgtaaacggtgtagaaaaggctatgatgcgcgt
caccgtgttgctctccgtttacttgcgacctggtttaacattgagtggattaaagtggaa
gcaattgagacaatggtcgcatgctctgccatggccattcagaagtctgctgaaatgaag
ggtgaagataatctaactcctacgacttcatgggctaagtggaagcgaggaggcatcatt
ggtgccgctgctattacaggaggcactttgatggccataactggtggattggctgctcca
gctatagctgcaggatttggtgcattggcaccaacactgggcacaattattccggtgatt
ggagctgggggttttgctgctgcggctagtgccgcaggaactgttgctggctccgttgcg
gttgcagcatcgtttggagctgctggagctggtctcacagggactaagatggcaaggaga
attggggaccttgatgagttcgaatttaaagctattggcgaaaatcataatcaaggacgg
ttagcagtggaagtcttggttgctggtgttgtttttgaagaagaagattttgtgaaacca
tgggaagggttaactagtaatctggagaggtacacgctgcaatgggagtccaagaatctt
atcttagtgagcacagcgattcaggattggcttacttcaagacttgcaatggaattgatg
aaacagggagcaatgcacactgtgttggcctctcttttaatggcattggcatggccagcg
acaatcttagtagctgctgatttcatagatagcaaatggagtattgctattgacaggtcg
gataaagcaggaagacttctagctgaagtgctacaaaaaggcttgcaaggaaatagaccc
atcactctagttggtttttcgcttggtgctcgtgtcatcttcaaatgcctccaagctctg
gctgagacagaacaaaacgctgaacttgtggagagagttgttcttcttggagcacccatt
tcaatcaatagtgaaaactggcgagacgtaaggaagatggtcgctggaagattcatcaat
gtttatgccacaaatgattggacccttggtatcgcatttcgtgctagtttaatttcccaa
ggattagccggaatccaaccaatatgtatccctggtatcgaaaacgtggatgtaaccgat
atggtggaaggtcactcttcatatctatggaaaactcagcagattttagaaagactcgag
atcgacacatattaccctgtttttcgagacactctttaa

DBGET integrated database retrieval system