KEGG   Arabidopsis thaliana (thale cress): AT4G36820Help
Entry
AT4G36820         CDS       T00041                                 

Definition
(RefSeq) calcium uniporter (DUF607)
  KO
K20858  calcium uniporter protein, mitochondrial
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ath03029]
    AT4G36820
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT4G36820
Mitochondrial biogenesis [BR:ath03029]
 Mitochondrial protein import machinery
  Inner mambrane
   Mitochondrial calcium uniporter complex
    AT4G36820
Transporters [BR:ath02000]
 Other Transporters
  Pores ion channels [TC:1]
   AT4G36820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MCU DUF1128
Motif
Other DBs
NCBI-GeneID: 829835
NCBI-ProteinID: NP_195400
MIPS: AT4G36820.1
TAIR: AT4G36820
Araport: AT4G36820
UniProt: Q1PE15
Position
4
AA seq 338 aa AA seqDB search
MVMMKKLLSNRLFNMSKTASQSLMNCRTSSSSSLAMRTRVPKDIGEATIDPEPGDLTISQ
RFLNKFSMNGIDTTSKMSIGESLMEKLKEMDMNKDRIRLDGLSHPKEETLGLTVQDVKKL
LRAAEIEVIKTKLMETGKIWIRYSDFLGVCSDSSLDPSQGALIAKMLDDSGNVIVMGNSV
CLRPHQLTKSIEGLLPLSQIHNPNDPRRKELNELEAIKTVIDQKAHSLVRRELWAGLGYL
IIQTAGFMRLTFWDLTWDVMEPICFYVSSVYFMAGYTFFLKTSREPSFQGFYQSRFEAKQ
RKLMQSEDFDVGRYDELKKLFNPKPSGAVPKILGSLQN
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggtgatgatgaagaagcttttgtcgaaccgtttgttcaatatgtcaaaaacggcgtcg
caaagtctcatgaactgtcgtacttcgtcttcttcttcgttagccatgcgaactagggtt
cctaaagatataggagaagccacgattgatccagagcctggagatttgacgatttctcag
aggtttttgaataaattctccatgaatgggattgatacgacttcgaagatgtctattggg
gagagtctgatggagaagcttaaagaaatggatatgaacaaggatcggattcgattagac
ggactttctcatccgaaggaggagacgttagggcttactgtgcaagacgtgaagaagttg
ctaagagcagcagagatcgaagttattaaaacgaagctgatggagacaggaaaaatctgg
attcgttactcagatttcttaggtgtttgtagtgattcttctttggatccttctcaagga
gctttgatcgctaagatgcttgatgattcaggaaacgttatcgttatgggaaactctgtt
tgtttaagacctcatcagttaaccaaatccatagaggggcttcttcctttatcacaaatc
cataacccgaatgacccaagaagaaaggagctaaatgagcttgaagctataaagacggtc
attgaccaaaaagcacattctttggtgagaagagagctttgggctggtttgggttacttg
atcatccaaaccgcagggtttatgaggctaacgttttgggacctgacatgggatgttatg
gaaccgatctgtttctatgtctcatcggtatatttcatggcgggttacacatttttcctc
aagacatcgagagagccttcctttcaaggtttttaccaaagcaggtttgaggctaaacaa
aggaaactgatgcaatctgaggattttgatgttgggaggtatgatgagctgaaaaagctg
tttaatcccaagccttcaggtgctgttcccaagattcttggatctctacagaattga

DBGET integrated database retrieval system