KEGG   Arabidopsis thaliana (thale cress): AT4G37250Help
Entry
AT4G37250         CDS       T00041                                 

Definition
(RefSeq) Leucine-rich repeat protein kinase family protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr LRR_8 LRR_4 LRRNT_2 LRR_6 S1FA Adeno_E3_CR2 Syndecan
Motif
Other DBs
NCBI-GeneID: 829879
NCBI-ProteinID: NP_195442
MIPS: AT4G37250.1
TAIR: AT4G37250
Araport: AT4G37250
UniProt: C0LGS3
Position
4
AA seq 768 aa AA seqDB search
MRMELISVIFFFFCSVLSSSALNSDGLVLMKFKSSVLVDPLSLLQTWNYKHESPCSWRGI
SCNNDSKVLTLSLPNSQLLGSIPSDLGSLLTLQSLDLSNNSFNGPLPVSFFNARELRFLD
LSSNMISGEIPSAIGDLHNLLTLNLSDNALAGKLPTNLASLRNLTVVSLENNYFSGEIPG
GWRVVEFLDLSSNLINGSLPPDFGGYSLQYLNVSFNQISGEIPPEIGVNFPRNVTVDLSF
NNLTGPIPDSPVFLNQESNFFSGNPGLCGEPTRNPCLIPSSPSIVSEADVPTSTPAIAAI
PNTIGSNPVTDPNSQQTDPNPRTGLRPGVIIGIVVGDIAGIGILAVIFLYIYRCKKNKIV
DNNNNDKQRTETDTITLSTFSSSSSSPEESRRFRKWSCLRKDPETTPSEEEDEDDEDEES
GYNANQRSGDNKLVTVDGEKEMEIETLLKASAYILGATGSSIMYKAVLEDGRVFAVRRLG
ENGLSQRRFKDFEPHIRAIGKLVHPNLVRLCGFYWGTDEKLVIYDFVPNGSLVNPRYRKG
GGSSSPYHLPWETRLKIAKGIARGLAYLHEKKHVHGNLKPSNILLGHDMEPKIGDFGLER
LLTGETSYIRAGGSSRIFSSKRYTTSSREFSSIGPTPSPSPSSVGAMSPYCAPESFRSLK
PSPKWDVYGFGVILLELLTGKIVSVEEIVLGNGLTVEDGHRAVRMADVAIRGELDGKQEF
LLDCFKLGYSCASPVPQKRPTMKESLAVLERFHPNSSVIKSSSFHYGH
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atgagaatggagttgatttcagtgattttcttcttcttttgctctgttttgagttcctct
gctttaaactctgatgggttggttttgatgaagtttaaatcctctgttcttgttgatcct
ctgtctttattacagacatggaattacaaacacgaaagtccatgttcttggagaggaatc
tcttgtaataacgattctaaagtcttaactttgtctcttcccaattctcagcttcttggt
tcgattccttctgatttgggttctctcttaacacttcaaagtctcgatctttccaataat
tccttcaatgggccattaccggtttctttcttcaacgctagagagcttcgtttccttgat
ctctctagtaacatgatctccggcgaaatcccttccgcaattggtgatcttcacaatctt
ctaaccctaaatctctctgataatgccttggcgggaaagttacctacaaatttggcgtcg
ttgagaaacttaacggtggtttctttggagaataattacttttccggcgagattcccggc
ggttggagagttgttgagttcttagacctgtcgtcgaatctgatcaatggctcgcttcct
ccggattttggcggatatagtctccagtacttaaatgtctcgtttaaccaaatctccggc
gaaattccaccggagatcggagtcaatttcccaagaaacgtcaccgttgatctctccttc
aacaatttaaccggtccaatccctgattctccggttttcttaaaccaggaatcaaatttc
ttttcaggaaacccgggtctatgcggtgaaccgacccgaaacccgtgtcttatcccttcc
tcgccgtctatcgtctccgaagccgacgtaccgacgtctacaccagcaatcgccgcaata
ccgaacacaatcggttcaaacccggttaccgatccaaattcacaacaaaccgacccaaat
ccccgaaccgggttacgacccggagttataatagggatcgtagtcggagatatcgctgga
atcggaatcctcgccgtgattttcctctacatctacagatgcaagaagaacaagatagtg
gataacaacaacaacgacaagcaaagaacagaaacagacacaattacgttatcaacattt
tcatcttcttcttcttcaccagaagagtcaagaagattcaggaaatggtcgtgtctacga
aaagatcctgaaacgacaccgtctgaagaagaagatgaagatgatgaagacgaagaaagc
ggttacaatgcaaatcaacggtcaggagataacaagttagtgaccgttgatggagagaag
gagatggagattgagactctgcttaaggcttcagcttatattttaggagccacaggttcg
agtataatgtataaagccgttcttgaagacggtagggttttcgcggttcgtcgactcggt
gaaaacggtttatctcagcgccggtttaaggattttgagccgcacattcgagccattggg
aaattggttcacccgaatttggttagactttgtgggttctattggggtaccgacgagaaa
ctagtcatttacgattttgtccctaacggcagcctcgtcaacccccgttaccgaaaagga
ggagggtcttcttcaccgtatcacctaccgtgggaaactcggctcaagatagcaaagggc
attgcacgtgggctggcttatctccacgagaagaagcatgtgcatggaaacttgaagcct
agcaacatacttttgggccatgacatggaacccaaaataggcgatttcggactcgaaagg
cttcttacaggcgaaacaagctacattcgagctggtggatcttctaggattttcagtagt
aagcgttacacaacttcctcgcgagaattctcgtctatcgggcctacaccaagcccgagt
ccgagctcggtgggggcgatgtcaccctactgcgcaccagagtctttccgaagcctaaaa
ccgagtccgaaatgggacgtttacggctttggagtgatccttctcgagcttctcacggga
aagattgtgtctgttgaagagattgtgctaggaaacggacttacggttgaggacgggcac
cgcgcagtgagaatggctgatgtggcgatccgcggcgagttagatggcaaacaagagttt
ttactcgattgtttcaagttaggctatagctgtgcgtctcctgttcctcaaaagaggcca
acgatgaaagaatctttggctgttcttgaaagattccatcctaactcctctgttattaag
tcttcatcgttccattacggacattaa

DBGET integrated database retrieval system