KEGG   Arabidopsis thaliana (thale cress): AT4G38160Help
Entry
AT4G38160         CDS       T00041                                 

Gene name
pde191
Definition
(RefSeq) Mitochondrial transcription termination factor family protein
  KO
K15032  mTERF domain-containing protein, mitochondrial
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ath03012]
    AT4G38160 (pde191)
   03029 Mitochondrial biogenesis [BR:ath03029]
    AT4G38160 (pde191)
Translation factors [BR:ath03012]
 Eukaryotic Type
  Release factors
   AT4G38160 (pde191)
Mitochondrial biogenesis [BR:ath03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    AT4G38160 (pde191)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: mTERF
Motif
Other DBs
NCBI-GeneID: 829972
NCBI-ProteinID: NP_001320159
MIPS: AT4G38160.1
TAIR: AT4G38160
Araport: AT4G38160
UniProt: Q9SZL6
Position
4
AA seq 333 aa AA seqDB search
MEVTNTSSIMWFFRDKGFDDPSIDKMLRKCKQLEKAQSDVASENWDYLSNIVGIQERKLP
YIVSRCPKILTLRLDERLIPMVECLSSLGRNPREVASAITKFPPILSHSVEEKLCPLLAF
FQALGVPETQLGKMILFNPRLISYSIDTKLTVIVSFLASLGLDQDGMIGKVLVKNPFLMG
YSVDKRLRPTTEFLKSSVGLSEDGIKSVVMNFPQLLCRDVNKILKPNYDYLKECGFGDSQ
IATMVTGYPQILIKSVKNSLQPRIRFLVQVMGRGMDEVASYPEFFHHGLKKKVESRFKLV
KKNNIDCSLREMLDCNTKKFHEKFGFSEVTASF
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgacaaatacgagcagcatcatgtggttcttcagggacaaaggtttcgatgat
ccgagtatcgacaagatgttgagaaaatgcaaacagttggaaaaggctcaaagcgatgtg
gcatcagaaaactgggactacctgagtaacattgttggtatccaagagagaaaactccct
tacatcgtctctcgatgccccaaaatcctgactttacgcctcgatgagagactcatcccg
atggtcgagtgcctctccagtcttggaaggaatcctcgggaagttgcttccgccattacc
aaatttcctccaatactctctcatagcgtggaggagaaactctgtccccttcttgctttc
tttcaagcgttaggtgtgcctgagactcaacttggcaaaatgatactttttaacccaagg
cttatcagctacagcatcgacaccaagctgacagtgatcgtcagctttcttgctagcctt
ggccttgatcaagatgggatgattggcaaagttctggtgaagaacccatttcttatgggg
tacagtgttgataaaaggttacggcctaccactgaattcttgaaatcatccgttggcctg
agtgaggatggcattaagtcggtggtcatgaatttcccacaacttttgtgcagagacgtt
aacaagattctcaaaccaaattatgattatttgaaggagtgtgggtttggagattcccag
atagcaaccatggtcactggttatccccaaatcttgattaagagtgttaagaattcacta
cagcctaggatcagattcctcgtccaggtgatgggaagaggcatggatgaagtggcttct
tatcctgaattctttcaccatggattgaagaagaaggtcgaatcgaggtttaaacttgtc
aaaaagaacaacattgactgcagccttagagaaatgctggactgtaacacaaagaaattc
catgagaagtttggcttttcggaggtaactgcaagcttctag

DBGET integrated database retrieval system