KEGG   Arabidopsis thaliana (thale cress): AT4G38230Help
Entry
AT4G38230         CDS       T00041                                 

Gene name
CPK26
Definition
(RefSeq) calcium-dependent protein kinase 26
  KO
K13412  calcium-dependent protein kinase [EC:2.7.11.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:ath00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    AT4G38230 (CPK26)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ath01001]
    AT4G38230 (CPK26)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AT4G38230 (CPK26)
Protein kinases [BR:ath01001]
 Serine/threonine kinases: CAMK group
  CDPK family
   AT4G38230 (CPK26)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase EF-hand_1 EF-hand_7 EF-hand_6 Pkinase_Tyr EF-hand_5 EF-hand_8 EF-hand_4 EF-hand_9 Kdo Kinase-like tRNA_synt_1c_R1 DUF374
Motif
Other DBs
NCBI-GeneID: 829980
NCBI-ProteinID: NP_001190950
MIPS: AT4G38230.1
TAIR: AT4G38230
Araport: AT4G38230
UniProt: Q9SZM3
Position
4
AA seq 484 aa AA seqDB search
MKHSGGNQACYVLGQKTPSIRDLYSLGHKLGQGQFGTTYMCKEISTGREYACKSITKRKL
ISKEDVEDVRREIQIMHHLAGYKNIVTIKGAYEDPLYVHIVMELCSGGELFDRIIQRGHY
SERKAAELIKIIVGVVEACHSLGVMHRDLKPENFLLVNKDDDFSLKAIDFGLSVFFKPGQ
IFEDVVGSPYYVAPEVLLKHYGPEADVWTAGVILYILVSGVPPFWAETQQGIFDAVLKGH
IDFDSDPWPLISDSAKNLIRGMLCSRPSERLTAHQVLRHPWICENGVAPDRALDPAVLSR
LKQFSAMNKLKQMALRVIAESLSEEEIAGLKEMFKAMDTDNSGAITFDELKAGLRRYGST
LKDTEIRDLMEAADIDKSGTIDYGEFIAATIHLNKLEREEHLLSAFRYFDKDGSGYITID
ELQHACAEQGMSDVFLEDVIKEVDQDNDGRIDYGEFVAMMQKGIVGRTMRKSINMSIRNN
AVSQ
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacagcggtgggaaccaagcctgctatgttcttggtcaaaagaccccaagcatc
cgagatctctactcgttgggacacaaactaggtcaaggacagtttgggacgacttacatg
tgcaaagagatctcaacagggcgtgaatacgcatgcaagtctataacaaaacgaaagttg
atatcaaaggaagatgtggaagacgtacgcagggaaattcaaatcatgcaccatctggct
ggctacaagaacattgtcaccattaaaggtgcttacgaggatccattgtatgttcacatc
gtgatggagctttgctcaggtggggaattgtttgacagaattatccagagaggacattac
agcgagagaaaagcagctgagctgataaagatcatcgttggtgttgttgaggcttgccat
tcgcttggtgtcatgcatagagatctaaagcccgaaaatttcttgttggttaacaaggac
gacgacttctctctcaaagccattgattttgggctttccgtgttcttcaaaccaggtcaa
atattcgaggatgtggttggaagtccgtattatgttgctcctgaggttctgctcaagcac
tacggacccgaggctgatgtgtggaccgcaggggtcatactgtacatattggtgagcgga
gtccctccgttctgggcagaaacacagcaagggatatttgatgcagtgctgaagggacat
attgactttgactccgacccttggcccctaatatccgactctgcaaaaaacttgatccgt
ggcatgctatgttcccggccctctgagcgactgacagctcatcaagtattgcgccatcct
tggatctgtgaaaatggagttgcgccagacagagcactagatcctgctgtgctttctcgt
cttaaacagttctctgcgatgaataaactaaagcagatggctttacgggtaatagctgag
agtctctcggaggaagaaattgctggactgaaggaaatgttcaaagcaatggacacggat
aacagtggagcgattacgtttgacgagctgaaagccgggttgcgaagatatggttcaacc
ctcaaggatactgagattcgtgaccttatggaggctgcagatattgacaagagtgggacc
atagattatggtgaattcattgctgcaacaatccatctgaacaaattagagcgtgaagaa
catcttctgtcagccttcaggtactttgacaaagatgggagcggttacatcactatcgat
gagctacagcacgcatgtgctgaacagggaatgagtgatgtctttctagaagatgtgatc
aaggaagtcgaccaagacaatgatggaaggattgactacggggagtttgtagctatgatg
cagaaaggcattgttggaagaacaatgaggaaaagcataaacatgagcatcaggaacaat
gccgtctcgcagtga

DBGET integrated database retrieval system