KEGG   Arabidopsis thaliana (thale cress): AT4G38570Help
Entry
AT4G38570         CDS       T00041                                 

Gene name
PIS2
Definition
(RefSeq) Putative CDP-diacylglycerol-inositol 3-phosphatidyltransferase 2
  KO
K00999  CDP-diacylglycerol--inositol 3-phosphatidyltransferase [EC:2.7.8.11]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00562  Inositol phosphate metabolism
ath00564  Glycerophospholipid metabolism
ath01100  Metabolic pathways
ath04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    AT4G38570 (PIS2)
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AT4G38570 (PIS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    AT4G38570 (PIS2)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.11  CDP-diacylglycerol---inositol 3-phosphatidyltransferase
     AT4G38570 (PIS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CDP-OH_P_transf
Motif
Other DBs
NCBI-GeneID: 830014
NCBI-ProteinID: NP_001328584
MIPS: AT4G38570.1
TAIR: AT4G38570
Araport: AT4G38570
UniProt: Q8GUK6 A0A178UUZ3
Position
4
AA seq 225 aa AA seqDB search
MAKQRPATLSVYLYIPNIVGYMRVLLNCIAFSVCFSNKTLFSLLYFFSFCCDAVDGWCAR
KFNQVSTFGAVLDMVTDRVSTACLLVILSQIYRPSLVFLSLLALDIASHWLQMYSTFLSG
KTSHKDVKDSTSWLFRLYYGNRMFMGYCCVSCEVLYIILLLIATNQTENLMNVVVKSLMQ
ISPLSLLLALSIFGWSIKQIINVIQMKTAADVCVLYDIEKQHKKP
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggctaaacagagaccggcgacgttgtcagtctacctctacattcccaatatcgttggg
tacatgagagttctcttgaactgcattgccttctctgtgtgcttctccaacaagacactc
ttctccctcttgtactttttcagtttttgttgtgatgctgtggatggatggtgcgctcgt
aaatttaaccaagtctctacatttggagctgttttggatatggttacagatagagtcagc
acagcctgtcttctcgtgattctctcccagatatacaggcctagcttggttttcctgtca
ttgctggctttagatatcgctagtcactggctgcaaatgtacagtaccttcctatcaggg
aagaccagccataaggatgtgaaagatagcacgagctggctctttagactctattatgga
aaccggatgttcatgggttattgctgtgtttcctgcgaggttctttatataatccttctt
ctcatagcaacgaaccaaaccgaaaacttgatgaacgtggtagtgaaatcattgatgcag
atttcaccgctctctttactcttggctttgagcatatttggttggtccatcaagcagatc
atcaatgtgattcagatgaaaacggctgcagatgtttgtgtcctgtatgacatagagaaa
cagcataagaagccttga

DBGET integrated database retrieval system