KEGG   Arabidopsis thaliana (thale cress): AT4G39460
Entry
AT4G39460         CDS       T00041                                 

Gene name
SAMC1
Definition
(RefSeq) S-adenosylmethionine carrier 1
  KO
K15111  solute carrier family 25 (mitochondrial S-adenosylmethionine transporter), member 26
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT4G39460 (SAMC1)
Transporters [BR:ath02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   AT4G39460 (SAMC1)
SSDB
Motif
Pfam: Mito_carr Gly-zipper_YMGG
Other DBs
NCBI-GeneID: 830101
NCBI-ProteinID: NP_001190968
MIPS: AT4G39460.1
TAIR: AT4G39460
UniProt: Q94AG6 A0A178UZZ4
Position
4
AA seq 325 aa
MAPLTLSVDVKSSSATSHDVSKRVMQSSQLKINKGFFASVNTQEDKPFDFFRTLFEGFIA
GGTAGVVVETALYPIDTIKTRLQAARGGGKIVLKGLYSGLAGNIAGVLPASALFVGVYEP
TKQKLLKTFPDHLSAVAHLTAGAIGGLAASLIRVPTEVVKQRMQTGQFTSAPSAVRMIAS
KEGFRGLYAGYRSFLLRDLPFDAIQFCIYEQLCLGYKKAARRELSDPENALIGAFAGALT
GAVTTPLDVIKTRLMVQGSAKQYQGIVDCVQTIVREEGAPALLKGIGPRVLWIGIGGSIF
FGVLESTKRTLAQRRPNTVKETKEE
NT seq 978 nt   +upstreamnt  +downstreamnt
atggctcctcttactctctccgttgatgtgaagagctcttcagcgacctctcatgatgtt
tcgaagagggtaatgcagagttcacagctcaaaataaacaaaggcttttttgcatctgtt
aatacacaagaagataaaccctttgatttcttccgcactctctttgaggggtttatagca
ggaggtacagctggagttgtagttgaaacagctttatacccaattgatactattaagact
agacttcaggcagctcgtggaggtggaaaaattgttttgaagggtctttattcaggatta
gctggaaatatcgctggtgtcttaccggcttcggctttatttgttggagtttacgaaccc
acaaagcagaaactgctgaagacctttcctgatcatttaagcgcagttgctcacctgact
gcaggggccatcggtggacttgctgcatctctgattcgagtgcctacagaggttgtgaag
caaagaatgcagaccggacagtttacatcagctcccagtgctgttcgaatgattgcatca
aaagagggatttaggggtctctatgcaggataccggtccttccttttgcgagatttgcca
tttgatgctatacagttctgcatatatgagcagctttgcttggggtataaaaaagccgcg
cgtagagagcttagtgatcctgagaacgctctaatcggtgcatttgctggtgctctgacc
ggagcagtcaccactccgcttgatgttattaagacaagattaatggttcagggatcagcc
aaacaatatcaaggaatcgttgactgtgttcaaacaattgtaagagaggaaggagctcct
gctctcttaaagggtattgggccaagagtgttgtggataggtattggaggatcaatcttc
tttggtgtcctcgagagcactaagagaacacttgcacagagacgtcccaatacggttaaa
gaaaccaaagaagaataa

DBGET integrated database retrieval system