KEGG   Arabidopsis thaliana (thale cress): AT5G01160
Entry
AT5G01160         CDS       T00041                                 
Name
(RefSeq) RING/U-box superfamily protein
  KO
K15685  E3 ubiquitin-protein ligase Hakai [EC:2.3.2.27]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ath03019]
    AT5G01160
   04131 Membrane trafficking [BR:ath04131]
    AT5G01160
   04121 Ubiquitin system [BR:ath04121]
    AT5G01160
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     AT5G01160
Messenger RNA biogenesis [BR:ath03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     AT5G01160
Membrane trafficking [BR:ath04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    AT5G01160
Ubiquitin system [BR:ath04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    AT5G01160
SSDB
Motif
Pfam: zf-C3HC4_3 zf-RING_UBOX zf-RING_5 zf-C3HC4
Other DBs
NCBI-GeneID: 831742
NCBI-ProteinID: NP_001331186
TAIR: AT5G01160
UniProt: Q9LFC0 A0A384KW62
Position
5:53856..56052
AA seq 360 aa
MLQIRLRRDSPTETGNGARPSPTETVTVACPDHLVLADLPVAKGIGSVTPTTVIKPVGRR
SRRQLGERVHFCVRCDFPIAIYGRLIPCDHAFCLECARSDSICYLCDERIQKIQTIKMME
GIFICAAPHCLRSFLKKLDFEAHVHDLHGSLLQADAEKEDGNQSDVQSTMQQSSASESTL
RAPLRSQLQQSRELNRSASFAKSQSGFSQVQNYPPDSDNSRPPGFETASPKPGIRFPDYP
QPMNLMQPPSLPVPMNQNPGLPQQFGFPSYPTTESGSSQQFFNGAQYEMTRTESGGSEQS
SLLGYPPPSPMTNLNFQGSYPPPSWNPGMAPPHTTQQVNRGRDGQSFGWPQENRDGFGQE
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgcttcaaattcgtcttcggagggattccccgacggaaactggaaatggtgcgaggcct
tctccgacggagacggttactgtagcctgtcccgaccatctcgtcctcgccgatcttcct
gttgcgaaaggaatcggttccgtgactcccaccaccgtaatcaagcccgtcggtcgtcgt
tctcgccgtcagctaggcgagagagttcacttctgcgttcgttgcgattttccgattgca
atctatggtcgtctgattccttgtgatcatgccttttgccttgaatgtgctcgcagtgat
tccatctgctatctatgtgatgagcggattcagaagattcaaacaatcaagatgatggaa
gggatcttcatctgtgcagctcctcattgtcttaggtctttcctgaagaaacttgacttt
gaagcccatgtccatgacctccatggaagcctattacaagccgatgcagagaaagaagat
ggtaaccagtcagatgttcagagcacaatgcagcagtcttcagcttcagaatccaccttg
cgagctcctttaagatcccagctgcaacaatcccgtgaactaaacaggtcggcgtcattt
gcaaagtcacagtctggatttagtcaagtccagaattaccctccagatagcgataactct
cgccctcctggattcgaaaccgctagtcctaaaccaggaatccggttcccagactacccc
cagcctatgaatcttatgcaaccgcccagcttgcccgttccaatgaatcaaaacccgggt
ttaccacagcagtttggttttccttcgtatccaacaacagagagtggatcatctcaacaa
ttctttaacggtgctcagtacgagatgacaagaacagagagcggcggatcagaacaaagt
tcattgctcgggtatcccccgccttcaccaatgacgaatctgaatttccaaggatcgtat
cctcctccatcatggaatcccggaatggcaccgcctcacacgacccagcaggttaaccgg
ggtagagacggtcaaagttttgggtggccacaagagaaccgtgatggctttgggcaggag
taa

DBGET integrated database retrieval system