KEGG   Arabidopsis thaliana (thale cress): AT5G01500
Entry
AT5G01500         CDS       T00041                                 

Gene name
TAAC
Definition
(RefSeq) thylakoid ATP/ADP carrier
  KO
K14684  solute carrier family 25 (mitochondrial phosphate transporter), member 23/24/25/41
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT5G01500 (TAAC)
Transporters [BR:ath02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   AT5G01500 (TAAC)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 831861
NCBI-ProteinID: NP_195770
MIPS: AT5G01500.1
TAIR: AT5G01500
UniProt: Q9M024
Position
5
AA seq 415 aa
MGEEKSLLQFRSFPSLKTSDFALTEEPSWRLENNVSSNRRRGNKRSGGVFTNFASLSVAI
RRDRRESTFNGRNGGGGGAFASVSVVIPKEEDEFAPTSAQLLKNPIALLSIVPKDAALFF
AGAFAGAAAKSVTAPLDRIKLLMQTHGVRAGQQSAKKAIGFIEAITLIGKEEGIKGYWKG
NLPQVIRIVPYSAVQLFAYETYKKLFRGKDGQLSVLGRLGAGACAGMTSTLITYPLDVLR
LRLAVEPGYRTMSQVALNMLREEGVASFYNGLGPSLLSIAPYIAINFCVFDLVKKSLPEK
YQQKTQSSLLTAVVAAAIATGTCYPLDTIRRQMQLKGTPYKSVLDAFSGIIAREGVVGLY
RGFVPNALKSMPNSSIKLTTFDIVKKLIAASEKEIQRIADDNRKKASPNTIDEQT
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgggagaagagaagtctctgcttcagttccgtagttttccttcactcaagacctctgat
ttcgctctcaccgaagaaccttcatggaggctggagaacaacgtgtcgtcgaatcgccgg
agaggaaacaagagaagcggtggcgtttttaccaattttgcgtccctttccgtagcgatt
aggagagatcggagagaatctacatttaacggtcgtaatggcggcggaggcggagcgttc
gcatcggtttcggtggtgattccgaaggaagaggatgaattcgcgcctacctcggcccag
ctgttgaaaaaccccattgctttactgtcgatagtaccgaaagacgccgcactattcttc
gccggagcgttcgccggagccgccgcaaagtcagtgacggcaccgcttgaccgaataaag
ctcctaatgcagacacatggtgttcgagctgggcaacaaagtgctaagaaggctattggt
ttcattgaggccattactcttatcggaaaggaagaaggtattaaaggttattggaaagga
aatctacctcaggtgataaggattgtaccttatagcgcagtccagttgtttgcatatgaa
acatacaagaaactcttcagggggaaagacggtcaattgtcagtcctcggaaggctcggt
gctggtgcttgtgctggcatgacgtctactctgattacataccctttagatgtgctgaga
ttgaggttagctgttgaaccaggttatcgaaccatgtcccaggttgccttgaacatgctg
cgggaggaaggagttgcatcattctacaacggtctaggtccttcgcttttaagtatagct
ccttacattgccatcaacttctgcgtctttgatctggtaaagaaatctctgccagagaag
tatcaacaaaagacacaatcatctttgttaacagcagtagtagctgctgctattgctacc
ggtacttgctatccattggataccattagaaggcagatgcaattgaagggtactccatat
aaatcggtattagacgctttctcaggtatcattgcgcgtgaaggagttgttggcttgtac
cgtggctttgtccccaatgcactcaaaagcatgccaaacagcagtattaagcttacaaca
ttcgacatcgtcaagaaactcatagcagcgagtgagaaggagatccaaagaatcgcggat
gataaccgcaagaaagcaagtcctaacacaatcgatgaacaaacctga

DBGET integrated database retrieval system