KEGG   Arabidopsis thaliana (thale cress): AT5G02930Help
Entry
AT5G02930         CDS       T00041                                 

Definition
(RefSeq) F-box/RNI-like superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: F-box F-box-like LRR_2 Corona_6B_7B
Motif
Other DBs
NCBI-GeneID: 831737
NCBI-ProteinID: NP_195913
MIPS: AT5G02930.1
TAIR: AT5G02930
Araport: AT5G02930
UniProt: Q9LYZ2
Position
5
AA seq 469 aa AA seqDB search
MRFKQPSRRDRPVMFKRSKNVSVDVGVDSISDLPDAVLQHIFSYIPTELAIRTSVLSKRW
RHVWSETPHLSFEWLKVSPKLINKTLASYTASKIKSFHLCTRYSYEADTHHVNSSIEFAM
SHNVDDLSLAFRRCSPFYNFDDCFYTNSSLKRVELRYVDLMPRCMVSWTSLKNLSLTDCT
MSDESFLEILSGCPILESLSLKFCMSLKYLNLSKSLRLTRLEIERISYIRAPMLSMQIVA
PYIHYLRLRDSEAHCTFVDVSSLTEANVDVSTFHPRTCYHDFDPLDPHDLLVMVQTMLKT
FQKVEKLTLGVNLLQMLSLSKIPSLPLPMLKVKTLTLETMIIRSVVPGIARLLQNLPGLK
KITVYTTNPCNTEVEPCVNSYLDAQDLNPDQWWRLDDVVFPISSEYEVLKPEIMASFMEL
LLANTRTLETLVVELGSCVARSRFKELFQIALTLSHDKKVSIMLKRSNG
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgagattcaaacaacctagccgtcgagatcgtcccgtcatgtttaaacgatcaaaaaat
gtttcagtcgatgttggtgtagactcaatcagcgatctacccgacgctgttctccaacat
atcttctcctatattccgacagagttggcgatcagaacctctgtcttgtccaaacgatgg
agacatgtatggtccgagacacctcatctctcctttgaatggctcaaggtttcccctaaa
ttgataaacaaaaccctagccagctacacggcttccaagatcaagagttttcatctctgt
acccgttacagctacgaggcagacactcaccatgttaacagctcgatcgagtttgcaatg
tctcacaacgtggatgatctttctctggcgttccgtagatgttcaccgttttacaatttt
gatgattgcttctacaccaactcctctctaaagcgagtcgagttgagatatgttgatttg
atgcccaggtgcatggtgtcttggacatcactaaagaacctgtctttgaccgattgtaca
atgtctgatgaatcctttcttgagattctgtctggttgtccaatcctggaaagcttgagt
ttgaagttttgtatgtcactcaagtatcttaatctgagtaaatcgctgcgcttgacaaga
ttggagatagaacgcatatcctatattcgagcaccaatgctgtctatgcagatcgtggcg
ccatatatccattatttgagattgagagactctgaggcacactgcactttcgttgatgtc
tcttctttaacagaagctaatgtcgacgttagcactttccatcctagaacctgttatcat
gattttgaccccttagaccctcatgatcttctagtcatggtgcaaacaatgctaaaaacg
tttcagaaagtagagaagcttactttgggggttaatttacttcagatgttatcactttcc
aagatccctagtcttccattgccgatgctaaaggtcaaaactttgactcttgaaacaatg
attatccgatctgtggttcctggtattgcaagactgctacaaaacttacctggattaaag
aagataacagtttacacaactaatccgtgcaacaccgaagtggagccatgtgttaacagc
tacttggacgcgcaagacttgaatccagatcaatggtggaggttagatgatgtggtcttt
ccgatatcttctgagtatgaagttttaaagccagaaattatggcatcgttcatggaactg
ttgctggcaaacacaagaacgctagagacattggttgtagagttgggaagttgcgttgct
agatcaagatttaaagagctgtttcagatcgcactcacgctttctcacgacaaaaaagtc
tcaattatgctcaagcgaagcaatggctga

DBGET integrated database retrieval system