KEGG   Arabidopsis thaliana (thale cress): AT5G03530Help
Entry
AT5G03530         CDS       T00041                                 

Gene name
RABC2A
Definition
(RefSeq) RAB GTPase homolog C2A
  KO
K07910  Ras-related protein Rab-18
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT5G03530 (RABC2A)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ath04031]
    AT5G03530 (RABC2A)
Membrane trafficking [BR:ath04131]
 Others
  Rab GTPases of specific organelles
   Lipid droplets
    AT5G03530 (RABC2A)
GTP-binding proteins [BR:ath04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab12/18
    AT5G03530 (RABC2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA RsgA_GTPase GTP_EFTU FeoB_N Septin SRPRB AAA_29 NACHT AAA_16 DUF815 ABC_tran MCM AAA_7
Motif
Other DBs
NCBI-GeneID: 831810
NCBI-ProteinID: NP_001332165
MIPS: AT5G03530.1
TAIR: AT5G03530
Araport: AT5G03530
UniProt: O49841 A0A178UJG3
Position
5
AA seq 210 aa AA seqDB search
MGSSSGQSGYDLSFKILLIGDSGVGKSSLLVSFISSSVEDLAPTIGVDFKIKQLTVGGKR
LKLTIWDTAGQERFRTLTSSYYRGAQGIILVYDVTRRETFTNLVDVWGKEIELYSTNQEC
VRMLVGNKVDRESERGVSREEGIALAKELNCMFLECSARTRQNVEQCFEELALKIMEVPS
LLEEGSSAVKRNILKQKPEHQTNTQSGCCS
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgggatcttcttctgggcaaagtggatacgatctgtcttttaagatcttgttgattggt
gattctggtgttggtaaaagcagtttgcttgtcagcttcatttctagctccgttgaagat
cttgctcctactattggtgttgatttcaagatcaaacaattgacagtaggaggcaaaagg
ctaaaactcacaatctgggacacagctggacaggaacggtttagaacactgacaagctct
tactacagaggcgcccaaggaatcattctcgtttatgatgtgacgagaagggagacattt
acaaacttagtagatgtgtggggtaaggagattgagctttactccacaaaccaagaatgt
gtaaggatgctcgttgggaacaaagtcgatagagaatctgagagaggagtaagcagagaa
gaagggattgctctagcaaaagaactcaactgcatgtttcttgagtgtagtgctagaact
cgacaaaacgtggaacagtgtttcgaagagttggctttgaagataatggaggtacctagt
ctcttggaagaaggatcaagtgctgtgaagagaaacatcttgaagcagaaaccagaacac
cagactaatactcaatccggctgttgcagctag

DBGET integrated database retrieval system