KEGG   Arabidopsis thaliana (thale cress): AT5G04190
Entry
AT5G04190         CDS       T00041                                 

Symbol
PKS4
Name
(RefSeq) phytochrome kinase substrate 4
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Other DBs
NCBI-GeneID: 830297
NCBI-ProteinID: NP_196039
TAIR: AT5G04190
UniProt: Q9FYE2
Position
5:1151114..1152334
AA seq 406 aa
MAQTTVTVVATKRDALDPYIKILQNRSNDIDVSFSSYLKPDNNEQQQKENEDTELSIFEA
RSYFSENGSNDSRCQTRNLSGPRFSSVASAKVSSFTVGQTASSEASWNSQTGLLSNKNRQ
GSDRDGRRSSKKGPRWFFRRRACPCSSSKSVQVQESKPRIAVPKTGSDRIVSNRIVHSHQ
TISSPEPIRLTIPSNTVTRSIDYTANKEARAPVSNFSFPTLNETSQLSENPKNPVLNHIK
PVRIEPALLPIKPVLNPTSPKGVIIDEEATSDASSDLFEIESFSTQTAARPWAPPVRDSM
EETVSEYGYEPSEASVTWSVMTAEPASAVAANFSRIALSSSSTAFSGYDKKRTGLLNCHC
EKAVMVNGDKRLVQPVKSVGVQNDVAGKVLCNNGSSKLSVTSRPRQ
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggcgcaaactactgtcactgtagtcgcgaccaaacgcgatgctcttgatccttacatc
aagattcttcagaatcgatcaaacgacatcgatgtctccttctcttcttacctcaaacca
gacaacaacgaacaacaacaaaaggagaatgaagatactgagctaagtatcttcgaagct
cgaagttactttagcgaaaacggaagcaacgatagtcgatgccagacgaggaatctaagt
ggtccaagattttcttcggtcgcatctgcaaaagtgtcttcttttaccgtgggacaaacg
gcatcctctgaagctagctggaacagccaaaccggtttgctctctaacaaaaaccgccaa
ggatcggacagagatggacgtagaagcagcaagaaaggaccaagatggttttttagacgc
agggcttgtccatgttctagctccaagtccgttcaggtccaagaatccaaaccaagaatc
gcagtgcccaaaaccggttctgaccgaatcgtctcgaaccgaatagttcatagtcatcag
acgatatcttcacctgagccaataagattaacgatcccttcaaacactgtgactcggtcc
atcgattacactgcaaacaaagaagctagagctccagttagtaattttagcttcccaact
ctaaacgaaacttcacaattatcagaaaatcccaagaatccggttttgaatcatattaaa
ccggtacgaattgaaccggctctgcttccgattaaaccggttctgaatcctacgagtccc
aagggagtcatcatagacgaagaagccacaagcgacgcaagctccgatctttttgagata
gagagcttctctactcaaaccgcagctcgtccatgggctccaccagtacgggactcgatg
gaagagaccgtgtctgagtacggttacgagccaagcgaagcaagtgttacttggagcgtt
atgaccgccgagccggcctcggccgttgcagctaacttctcaagaattgccttgtcgtca
tcgtctacagcatttagtggttacgataagaagagaaccggtttgttgaactgtcattgt
gagaaggcggttatggttaacggcgataagcgtttagtgcaaccggttaagagcgttggt
gttcaaaacgacgtcgcgggaaaggtgttgtgcaacaatggcagttctaaactaagcgtg
acgagtagaccaaggcaatga

DBGET integrated database retrieval system