KEGG   Arabidopsis thaliana (thale cress): AT5G04820Help
Entry
AT5G04820         CDS       T00041                                 

Gene name
OFP13
Definition
(RefSeq) ovate family protein 13
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Ovate
Motif
Other DBs
NCBI-GeneID: 830361
NCBI-ProteinID: NP_196102
MIPS: AT5G04820.1
TAIR: AT5G04820
Araport: AT5G04820
UniProt: Q9FMC8
Position
5
AA seq 260 aa AA seqDB search
MGKKKMKLSSLFKGGAGGLLAVPLCYNAKTLSFRVGDDMIKTVNSVFFDHHHNNNNGGDL
LEAETPESWFTNSSETASHSTESDQDLDAESLEMVVRGVVRSERLFFDPGVTSSILEEIE
EKSKSDLKSKETVAVGEDRSTPIEEISVAVAMESEDPYGDFRRSMEEMVTSHGELAKDWE
SLESMLAWYLRMNGRKSHGVIVSAFVDLLSGLSDSGAGITSASVSDSARYSTAVSSLPSS
PVYSLSQGQTEIQEEERRSC
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaagaagatgaaactctcttctctgttcaaaggcggagccggaggattacta
gcggttcctctctgttacaatgccaaaactctttcgttccgagtcggcgacgacatgatc
aagacggtgaactctgttttcttcgaccaccaccacaacaacaacaatggaggagatttg
ttggaagcggagacgcctgagtcatggtttactaactcgtccgagacagcgagtcactca
accgagtcggatcaagaccttgacgctgagtccttagagatggtggttcgtggcgttgtt
agatcggagcggttattcttcgatccaggagttacgagttcgattctggaagagattgaa
gagaaatcgaaatcggatttgaaatcgaaggaaacggttgcggtgggagaagatcggagt
acgccgattgaggagattagtgtcgcggtggcgatggaatccgaggatccgtacggtgat
ttccggcgatcgatggaggagatggtgacgagtcacggtgagttggctaaagattgggag
agcttggaatcgatgctcgcttggtatttgaggatgaatgggaggaagagtcacggcgtt
atcgtcagtgcttttgttgatcttctctctggactctctgattccggcgccggaataacg
tcggcttcggtatcggattcggctcgttattcaaccgccgtttcgtctttgccgtcgtcg
ccggtttattcgttatctcaaggtcagacggagattcaagaggaagagagacggagctgt
taa

DBGET integrated database retrieval system