KEGG   Arabidopsis thaliana (thale cress): AT5G04900Help
Entry
AT5G04900         CDS       T00041                                 

Gene name
NOL
Definition
(RefSeq) NYC1-like protein
  KO
K13606  chlorophyll(ide) b reductase [EC:1.1.1.294]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00860  Porphyrin and chlorophyll metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AT5G04900 (NOL)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.294  chlorophyll(ide) b reductase
     AT5G04900 (NOL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase Polysacc_synt_2 GDP_Man_Dehyd F420_oxidored NAD_binding_2
Motif
Other DBs
NCBI-GeneID: 830372
NCBI-ProteinID: NP_568145
MIPS: AT5G04900.1
TAIR: AT5G04900
Araport: AT5G04900
UniProt: Q8LEU3 A0A178UDW6
Position
5
AA seq 348 aa AA seqDB search
MATWSGFNVSSSPLLRLRSSSVSNVTKLPFLSPICRRRLLAERFGLATVVVTRQNLTVTP
SSAAVEARISGKREPMTPPYNILITGSTKGIGYALAREFLKAGDNVVICSRSAERVETAV
QSLKEEFGEHVWGTKCDVTEGKDVRELVAYSQKNLKYIDIWINNAGSNAYSFKPLAEASD
EDLIEVVKTNTLGLMLCCREAMNMMLTQSRGGHIFNIDGAGSDGRPTPRFAAYGATKRSV
VHLTKSLQAELQMQDVKNVVVHNLSPGMVTTDLLMSGATTKQAKFFINVLAEPAEVVAEY
LVPNIRAIPASGSMKPTYIRFLTGIKAYTKIFSRVALGARKNRYVTEE
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggctacttggagtggtttcaacgtctcttcttctccgttgcttaggcttcggtcttcc
tccgtctcaaatgtcactaagcttccgtttctctctcctatttgccggcgtcggttactg
gcagaacgctttggtctcgcaactgtcgttgttacgcgccaaaacctcacggttactccg
tcgtctgcggcggtggaagctcgtatctcagggaaaagagaacctatgacgcctccgtat
aacatattgatcactggctcaaccaaaggtataggatatgcattagctagagagtttctg
aaagcaggcgacaatgttgtgatttgctctagatcagctgaacgagttgagactgctgtt
cagagtcttaaggaagaatttggggagcatgtgtggggaactaagtgtgatgttacggaa
gggaaggatgtgagggaacttgtagcttatagtcagaagaatcttaaatacattgacatt
tggataaataatgcgggatctaatgcatatagctttaaacctttggcagaggcctcagat
gaggatcttattgaagttgtgaaaaccaacactctaggtctcatgttatgttgccgagag
gcaatgaatatgatgttgacccaatctcgaggtggtcatatcttcaatattgatggagct
ggttcagatgggagaccaacacccagatttgctgcatatggtgcaactaaacggagtgtc
gttcacctgacaaagtcattacaggcagagttgcagatgcaagatgtcaaaaatgtcgtg
gtgcataatctatcgcctggaatggtcacaactgatctgctcatgtccggagcaactaca
aaacaagccaagttcttcattaatgttttggcagagccagccgaagtggtggctgagtac
cttgtcccaaacataagggcaataccggctagcggatctatgaagccgacttacatccgt
ttcctaactggaatcaaagcctacaccaaaatattctcaagagttgcgttgggagcaagg
aagaacaggtatgttactgaagagtag

DBGET integrated database retrieval system