KEGG   Arabidopsis thaliana (thale cress): AT5G04970Help
Entry
AT5G04970         CDS       T00041                                 

Definition
(RefSeq) Plant invertase/pectin methylesterase inhibitor superfamily
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00040  Pentose and glucuronate interconversions
ath01100  Metabolic pathways
Module
ath_M00081  Pectin degradation
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AT5G04970
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     AT5G04970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pectinesterase PMEI Pectate_lyase_3
Motif
Other DBs
NCBI-GeneID: 830379
NCBI-ProteinID: NP_196116
MIPS: AT5G04970.1
TAIR: AT5G04970
Araport: AT5G04970
UniProt: Q9FF77
Position
5
AA seq 624 aa AA seqDB search
MQTHSSSLVFLALLCLSWALLVSPTRPPSQPPSHPPIQPSSQPPTQPPSQPPTQPPTQPP
SHPPTQPPTPPPSQSPSQPSPLPPNIACKSTPYPKLCRTILSAVKSSPSDPYHYGKFTMK
QCLKQARRLSKVINRFAQRVEADPGTSTVEEVSAVADCGELAELSVEYLETVTEELKAAE
LMTAALVDRVTSLLGGVVTNQQTCLDGLVDAKSGFATAIGTPLGNLTRLYSVSLGLVSHA
LNRNLKRYKGSKGKIFGGGNKPVREPLETLIKVLRKTCDKGKDCRKANRNLGELGETSGG
SILVREAVTVGPYETDNFPTITEAVAAAPNHTFPEQGYFVIYARAGLYEEYVVISNKKRN
IMLIGDGINKTIISGNHSFIDGWTTYNSSTFAVVGDRFVAVDVTFRNTAGPEKHQAVAVR
NNADGSTFYRCSFEGYQDTLYVHSLRQFYRECDIYGTIDFIFGNAAAIFQNCNIYARKPM
ANQKNAVTAHGRTDPNQKTGISIINCTIGAAPDLAADPKSTMTFLGRPWKPYSRTVYIQS
YISDVVQPVGWLEWNGTTGLDTISYGEYDNFGPGADTSKRVQWSGYSLLNLVQAMNFTVY
NFTLGDTWLPQTDIPFYGGLLHTE
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactcattcttcatctctcgtgttcttggctcttctctgtctgtcatgggcttta
ctagtctcaccaacacgtcctccgtcacaacctccatcacatcctccaatacagccttcg
tcacagccgccaacacagcctccgtcacagccaccaacgcagcctccaacacagcctccg
tcacatccaccaacacagcctccaacaccgccaccatcacagtctccatcgcagccttct
ccactaccaccaaacatcgcttgtaaatccactccttacccaaagctctgccgcacgatc
ctctccgccgttaaatcatcaccttccgatccttaccattacggaaagttcacaatgaag
caatgcctcaaacaagctcgtcgcctctccaaagtcatcaaccgctttgcccagcgcgtg
gaagctgatccaggtacgtcgacggtggaagaggtcagtgcggtggctgattgcggtgag
ctagcagagcttagcgtcgaataccttgaaacggttacggaggagctgaaagcggcggag
ctgatgacggctgcgctcgttgatcgtgtcacgagtcttctcggtggcgttgtgactaat
cagcagacgtgcctcgacggtcttgtggacgctaagagcggatttgcgacggcgattgga
acgccgttagggaatctaacgcgcctctacagtgtgtcgttggggcttgtgagtcacgcg
cttaaccgtaatttgaagaggtataaaggttccaaggggaaaatctttggtggtggtaac
aaacccgttcgtgaacctctcgagactttgattaaggttttacgcaaaacatgcgacaag
ggcaaagattgtcggaaagctaacagaaatttaggtgagctaggagagacgagcggtgga
tcgatcctcgtaagggaagcagtgaccgtcggtccatatgaaaccgataacttccccacc
ataactgaggccgttgctgccgcacctaatcacacattcccggagcaaggctacttcgta
atctatgcaagggcaggtctttacgaagaatatgttgtcatttcaaataaaaaaagaaac
ataatgcttattggggacggaatcaataaaactatcatttctggaaaccacagttttatt
gatggttggacaacgtataattcttcgacctttgcggtggtgggagaccgatttgttgcg
gttgatgtgacattccgaaacacagctggaccagagaagcaccaggctgtggccgtaaga
aacaatgcggatggatcgacattttatcgatgtagttttgaaggctatcaagatactctt
tacgttcattctttgagacagttctatcgtgaatgtgatatatatgggaccatagatttt
atattcggaaatgcagctgccatatttcaaaactgcaacatatatgcccgaaaaccgatg
gcaaatcagaagaatgcagtgacagcccatggaagaactgacccaaaccagaaaactgga
atctccatcattaattgtactattggagctgccccggacctcgctgctgaccccaagtcg
accatgacattccttgggcggccatggaagccttactcgaggacggtctacatacaatca
tacatcagcgatgttgtccaaccggtagggtggctggaatggaatggtacaaccgggcta
gacacgatctcctatggtgaatatgacaattttggaccgggggctgatacaagtaaaagg
gtccaatggtcaggatatagcctattgaacttggtacaagccatgaacttcaccgtatat
aatttcactttgggagacacttggttgcctcagactgacattcccttctacggcggtttg
cttcacaccgaatga

DBGET integrated database retrieval system