KEGG   Arabidopsis thaliana (thale cress): AT5G05610
Entry
AT5G05610         CDS       T00041                                 

Gene name
AL1
Definition
(RefSeq) alfin-like 1
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: Alfin PHD Zf_RING
Other DBs
NCBI-GeneID: 830444
NCBI-ProteinID: NP_196180
MIPS: AT5G05610.1
TAIR: AT5G05610
UniProt: Q9FFF5 A0A178UPZ2
Structure
PDB: 
5Y20

Position
5
AA seq 241 aa
MAAESSNPRTVEEIFKDFSGRRSGFLRALSVDVDKFYSLCDPEMENLCLYGHPNGTWEVN
LPAEEVPPELPEPALGINFARDGMQRKDWLSLVAVHSDCWLLSVSSYFGARLNRNERKRL
FSLINDLPTLFEVVTGRKPIKDGKPSMDLGSKSRNGVKRSIEGQTKSTPKLMEESYEDED
DEHGDTLCGSCGGNYTNDEFWICCDVCERWYHGKCVKITPAKAESIKQYKCPSCCTKKGR
Q
NT seq 726 nt   +upstreamnt  +downstreamnt
atggccgctgagtcttctaaccctcgcaccgtcgaagagatcttcaaggattttagcggt
cgtcgctccggttttcttcgagctctctccgtagatgttgacaagttctactctttatgc
gatccggaaatggagaatctgtgtttgtacggacacccgaatgggacatgggaagtgaat
cttccagctgaggaagtgcctccggagctacctgagccagctcttggaatcaatttcgct
agagatggtatgcagcgtaaagattggctctctttagttgctgtccacagtgattgttgg
ttactctctgtttcttcttacttcggcgctcgtcttaatcgcaatgagaggaaacgtcta
tttagtctgatcaacgatctcccaactctctttgaagtagtgacgggtaggaaacccatc
aaagacggtaaaccaagcatggatctcggaagcaaatccagaaacggcgtaaagagatca
attgaagggcagacaaagagcacgccgaaactaatggaagagagctatgaagatgaagac
gatgagcatggagacacactctgtggaagttgtggaggaaactacacaaacgacgagttc
tggatatgttgtgatgtgtgtgaacgttggtaccatgggaagtgtgtgaagataacacca
gccaaagcagagagcatcaagcaatacaaatgcccttcttgctgcactaagaaaggaaga
cagtga

DBGET integrated database retrieval system