KEGG   Arabidopsis thaliana (thale cress): AT5G06540Help
Entry
AT5G06540         CDS       T00041                                 

Definition
(RefSeq) Pentatricopeptide repeat (PPR) superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: PPR PPR_2 DYW_deaminase PPR_1 PPR_3 PPR_long AsiA
Motif
Other DBs
NCBI-GeneID: 830542
NCBI-ProteinID: NP_196272
MIPS: AT5G06540.1
TAIR: AT5G06540
Araport: AT5G06540
UniProt: Q9FG16
Position
5
AA seq 622 aa AA seqDB search
MSNIVLNTLRFKHPKLALLQSCSSFSDLKIIHGFLLRTHLISDVFVASRLLALCVDDSTF
NKPTNLLGYAYGIFSQIQNPNLFVFNLLIRCFSTGAEPSKAFGFYTQMLKSRIWPDNITF
PFLIKASSEMECVLVGEQTHSQIVRFGFQNDVYVENSLVHMYANCGFIAAAGRIFGQMGF
RDVVSWTSMVAGYCKCGMVENAREMFDEMPHRNLFTWSIMINGYAKNNCFEKAIDLFEFM
KREGVVANETVMVSVISSCAHLGALEFGERAYEYVVKSHMTVNLILGTALVDMFWRCGDI
EKAIHVFEGLPETDSLSWSSIIKGLAVHGHAHKAMHYFSQMISLGFIPRDVTFTAVLSAC
SHGGLVEKGLEIYENMKKDHGIEPRLEHYGCIVDMLGRAGKLAEAENFILKMHVKPNAPI
LGALLGACKIYKNTEVAERVGNMLIKVKPEHSGYYVLLSNIYACAGQWDKIESLRDMMKE
KLVKKPPGWSLIEIDGKINKFTMGDDQKHPEMGKIRRKWEEILGKIRLIGYKGNTGDAFF
DVDEEEKESSIHMHSEKLAIAYGMMKTKPGTTIRIVKNLRVCEDCHTVTKLISEVYGREL
IVRDRNRFHHFRNGVCSCRDYW
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacattgtgctcaacacacttcgattcaaacacccgaagcttgccttgctccaa
tcctgctcttccttttccgacctcaagatcatacatggctttctcttacgaacccatctc
atctccgacgtcttcgttgccagtcgtctcctcgctctctgcgttgacgactccaccttc
aacaaaccaaccaatctcttgggatatgcatacggaatcttctctcagattcaaaaccct
aatcttttcgtcttcaatctactcattcgctgcttctccactggtgcagagcctagtaag
gcttttgggttctatacccagatgttgaaatctcggatttggccagataacatcacgttt
ccgtttctgattaaggcgtctagtgagatggagtgtgttctagtgggagagcaaacgcat
tcacagattgttagattcggatttcagaatgatgtttatgtagagaattcgcttgttcat
atgtacgctaattgtgggttcatcgctgctgctggtagaatctttgggcaaatggggttt
cgagatgttgtttcatggacttctatggtggctgggtattgtaaatgcgggatggttgag
aatgcacgagagatgttcgatgaaatgcctcacagaaatttgtttacttggagtattatg
attaatgggtatgcgaagaacaactgttttgagaaagccattgacttgtttgaattcatg
aaaagggaaggagttgtcgcgaatgagacggttatggtgagtgtgatttcgtcttgtgct
catttgggtgcacttgagtttggagaaagagcatatgagtatgtggttaagagtcacatg
actgtgaatcttattcttgggacagctcttgtggatatgttttggaggtgtggggatatc
gagaaagcaattcatgtatttgagggattgcctgagacggatagcttgagctggagttca
ataatcaaaggtcttgcagtgcatgggcatgctcacaaggcaatgcattacttctcccaa
atgattagtttagggtttattccaagggatgttacattcacagcggttctttcagcttgc
agccacggtggattagttgaaaaagggttagagatatatgagaacatgaaaaaggatcat
gggatcgagcctagactcgagcattatggttgcattgttgatatgcttggtcgtgctggg
aaattagccgaagcggagaactttatccttaaaatgcatgtgaagccaaacgctcctata
ttgggagcattgcttggagcatgtaagatttataagaacaccgaggttgcagagagagta
ggaaacatgttgataaaggtgaaaccagaacatagcggttactatgtcttactgtcaaat
atatacgcgtgtgcaggacaatgggataagatagagagcttgagagacatgatgaaggag
aagcttgttaagaaaccaccagggtggagcttaatagagattgatgggaaaataaacaag
ttcacaatgggagatgatcagaagcatcctgaaatgggtaagatcagaaggaagtgggaa
gagatcttggggaagataagattgatagggtataaagggaacacaggtgatgcgtttttc
gatgtagacgaggaggagaaggagagttcgattcatatgcatagtgagaaacttgcaatt
gcatatggtatgatgaagactaagcctggtacaaccattaggatagtgaagaacttgagg
gtatgtgaagattgtcatacagtaacaaagcttatctctgaggtttatggtagagagtta
attgtaagagaccgcaacagatttcatcattttagaaatggagtatgttcctgcagagat
tattggtga

DBGET integrated database retrieval system