KEGG   Arabidopsis thaliana (thale cress): AT5G06810Help
Entry
AT5G06810         CDS       T00041                                 

Definition
(RefSeq) transcription termination factor family protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: mTERF RuvA_C
Motif
Other DBs
NCBI-GeneID: 830572
NCBI-ProteinID: NP_196299
MIPS: AT5G06810.1
TAIR: AT5G06810
Araport: AT5G06810
UniProt: F4K588
Position
5
AA seq 588 aa AA seqDB search
MKLRQNPSRFTSVLKWVSQLSLETQLKPSISGTGFLLRCAQTPRSFATVTGNEVCSEKSK
VKRTRNGFKITPNVRKLAEEAMLDYFYSTRGLQYMVAESMSKNSPIFIDNLLKKVDCVTA
SDINQSITRYLRFHPVNEFEPFLESSGLNPSEYNHLVPCDKVFLDEEGFLLENHHVLCYS
GVDPKRIGKIFKEAREVFSYETGVLASKIKAYEDLGFSRLFLSKLIVCSPRVLMGHTNIE
LVQVVKTLQSLGFEFEWVMENLSDEGPDWSSVHRVLSLLREICFDEEKLYGLIRNCPSLL
FENSGKWTGILVGFETKLGASRSELCSLFQKFPLIQVEKCVSNLRQCFLFLKEIEMEDDE
IHKVFRSHSWWLGSCKLKKTSSLLVFLKAGKTRVCQVIQENPEEMKKWTMGSKIQPLPAT
NVDIESKSMKTQFLLDLGYKENSEEMETAMKNFRGKGSELRERFNVLVSLGFTKKDVKDM
VKACPTMLSQTCDILESKVNYLIKELGYPLSTLVDFPSCLKFTLQRMKLRFAMFSWLQAR
GKVDRKIKVSTMLACSDKIFVSFFVNRHPDGSKHLEDLKKLHLSVETN
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttcggcaaaaccctagtagattcacgtctgttctcaaatgggtatcacaactt
tctctagaaacccaattaaaaccctcaatttctggaactgggtttctcctccgatgtgcc
caaacccctagatctttcgccaccgtcaccggtaacgaagtttgcagtgagaaatcgaaa
gtgaagagaacccgaaatgggtttaaaatcactcccaatgttaggaaattagctgaggaa
gcaatgttggattatttctattccactaggggtttacagtatatggttgcagagagtatg
agcaagaacagtccaatttttattgataatcttttgaagaaagttgattgtgttactgct
tctgatatcaaccaatctattactcgatatctacggtttcaccctgtcaatgaattcgag
cctttccttgagagttcaggtttgaatcccagtgagtataatcatttggttccctgtgat
aaggtcttcttggatgaagaaggctttttgctggagaaccatcatgttttgtgttatagt
ggtgttgaccctaagaggattgggaagatcttcaaggaagctagggaagtttttagttat
gaaaccggggttttagcttctaagattaaggcgtatgaggatttggggtttagcagattg
tttctatctaagcttatcgtttgtagtccgagagtcttgatgggtcatacgaatattgaa
ctggttcaggttgtaaagacgttgcaatctttagggtttgagttcgagtgggtaatggaa
aacttgtcagatgagggacctgattggagctctgtgcatcgtgttttaagcttgcttaga
gaaatctgttttgatgaggaaaaactatatgggttaatcaggaactgtccaagtttgctt
tttgagaattcagggaaatggacagggattctagttgggtttgaaacaaagcttggggca
tctagaagtgaactatgttcgttgtttcagaaattcccgctgattcaagtagagaaatgt
gtttcgaatctaaggcagtgcttcttgttcttgaaagagatcgagatggaagatgatgag
attcataaggttttccgttctcattcctggtggcttggttcatgtaagttaaagaaaacc
agtagcttgcttgtgtttttgaaggctggtaaaactcgggtttgtcaggtcattcaagaa
aaccctgaagagatgaaaaaatggacaatgggttcaaaaatccagccgttaccagctacc
aacgtagacattgagtcgaaatcaatgaagactcagttcttattagacctcggatacaaa
gaaaactcagaggaaatggagacagcaatgaagaatttccgtggtaaaggatcagaactc
cgagagagatttaatgtcctcgtaagtttgggttttaccaagaaagatgtcaaagatatg
gtgaaagcatgtcctactatgctctcccagacctgtgatatcctagaatcaaaggtgaac
taccttataaaggaattaggttatccgctttcgactttggtggatttcccttcatgttta
aagttcactcttcagcggatgaagctcagatttgcaatgttctcttggcttcaagcccga
ggaaaagtagaccgcaagatcaaagttagcacaatgctcgcttgctcggacaaaatattc
gtgagtttttttgtaaaccgtcatcctgatgggtctaagcatttagaggatctgaagaag
ctgcatctttcagttgaaacaaactaa

DBGET integrated database retrieval system