KEGG   Arabidopsis thaliana (thale cress): AT5G07060
Entry
AT5G07060         CDS       T00041                                 

Gene name
MAC5C
Definition
(RefSeq) CCCH-type zinc fingerfamily protein with RNA-binding domain-containing protein
  KO
K12872  pre-mRNA-splicing factor RBM22/SLT11
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    AT5G07060 (MAC5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ath03041]
    AT5G07060 (MAC5C)
Spliceosome [BR:ath03041]
 Complex B
  Other components
   Prp19-related factors
    AT5G07060 (MAC5C)
 Complex C
    AT5G07060 (MAC5C)
SSDB
Motif
Pfam: Torus zf_CCCH_4 RRM_1 zf-CCCH zf-CCCH_2 zf-CCCH_3 zf-CCCH_4 FYVE
Other DBs
NCBI-GeneID: 830597
NCBI-ProteinID: NP_196323
MIPS: AT5G07060.1
TAIR: AT5G07060
UniProt: Q9FL40
Position
5
AA seq 363 aa
MSHRDHGADGWESADFPITCESCFGDNPYMRMTRADYDKECKICSRPFTAFRWRPGRNAR
FKKTEICQTCSKLKNVCQVCLLDLGFGLPVQVRDSALNINSHYSVPMSHVNREYFADEHD
PKTRAGLDYESSFGKMQPNDTILKLQRRTPSYEKNRPKICSFYTIGQCKRGAECSFRHEM
PETGELSHQNIRDRYYSVNDPVAMKLLRKAGEMGTLEPPEDESIKTLYVGGLNSRIFEQD
IHDHFYAYGEMESIRVMAEDGKYDQSGSNQQQQGSIAHTGLISQQQNQHSQMQQYYMQPP
PPNEYSHYPSMDTQRMGAAFSTQESDGSSTSENNRAYSSYSYPMPPHQPYPTPPPYIDIY
IYI
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgtctcacagggatcatggagccgatggatgggaaagcgccgatttcccaatcacctgc
gaatcttgcttcggtgacaatccgtacatgcgaatgacccgagcggattatgataaggaa
tgcaagatatgtagtcgtcctttcacagcttttaggtggcgaccaggccggaatgctaga
ttcaagaaaaccgagatttgtcaaacttgctctaagctaaaaaatgtatgccaagtctgt
cttctggatctcggttttggtcttcctgttcaggtcagagactcagcactcaatattaat
tctcactactctgtcccaatgagccatgtcaacagagagtactttgctgacgagcatgac
ccaaagactagagctggactggattatgaatcttcatttgggaagatgcaacctaatgat
actattttaaagcttcagagaagaacaccttcctatgaaaagaaccggccaaaaatttgt
agtttctacaccattggtcagtgtaaaagaggtgccgaatgttcattccggcatgagatg
cccgaaacaggagagctatcccatcaaaacataagagatcgttattatagtgtaaatgat
ccagtcgcgatgaagttactcagaaaagctggtgagatgggcactttggaaccaccagag
gatgaaagcatcaaaacactttacgtcggtggacttaactcaagaatctttgagcaggac
atacatgaccacttctacgcttatggagaaatggaatctatcagagtcatggccgaggat
ggcaaatatgatcaaagtggttcaaaccaacagcaacagggcagtatcgctcatactgga
ttaatatctcagcagcagaatcaacactcacaaatgcagcagtactatatgcagccacca
ccacctaacgaatacagtcattacccatcaatggacacgcagagaatgggtgcagccttt
tcaacccaagagagtgatggttcaagcaccagtgagaacaacagagcttattcttcttac
tcttacccgatgccaccacaccagccgtaccccacaccaccaccatatatagatatatat
atatatatatga

DBGET integrated database retrieval system