KEGG   Arabidopsis thaliana (thale cress): AT5G07990Help
Entry
AT5G07990         CDS       T00041                                 

Gene name
TT7
Definition
(RefSeq) Cytochrome P450 superfamily protein
  KO
K05280  flavonoid 3'-monooxygenase [EC:1.14.14.82]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00941  Flavonoid biosynthesis
ath00944  Flavone and flavonol biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    AT5G07990 (TT7)
   00944 Flavone and flavonol biosynthesis
    AT5G07990 (TT7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ath00199]
    AT5G07990 (TT7)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.82  flavonoid 3'-monooxygenase
     AT5G07990 (TT7)
Cytochrome P450 [BR:ath00199]
 Cytochrome P450, plant type
  CYP75 family
   AT5G07990 (TT7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 830693
NCBI-ProteinID: NP_196416
MIPS: AT5G07990.1
TAIR: AT5G07990
Araport: AT5G07990
UniProt: Q9SD85 A0A178UNZ9
Position
5
AA seq 513 aa AA seqDB search
MATLFLTILLATVLFLILRIFSHRRNRSHNNRLPPGPNPWPIIGNLPHMGTKPHRTLSAM
VTTYGPILHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAP
YGHRWRLLRKISSVHLFSAKALEDFKHVRQEEVGTLTRELVRVGTKPVNLGQLVNMCVVN
ALGREMIGRRLFGADADHKADEFRSMVTEMMALAGVFNIGDFVPSLDWLDLQGVAGKMKR
LHKRFDAFLSSILKEHEMNGQDQKHTDMLSTLISLKGTDLDGDGGSLTDTEIKALLLNMF
TAGTDTSASTVDWAIAELIRHPDIMVKAQEELDIVVGRDRPVNESDIAQLPYLQAVIKEN
FRLHPPTPLSLPHIASESCEINGYHIPKGSTLLTNIWAIARDPDQWSDPLAFKPERFLPG
GEKSGVDVKGSDFELIPFGAGRRICAGLSLGLRTIQFLTATLVQGFDWELAGGVTPEKLN
MEESYGLTLQRAVPLVVHPKPRLAPNVYGLGSG
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggcaactctatttctcacaatcctcctagccactgtcctcttcctcatcctccgtatc
ttctctcaccgtcgcaaccgcagccacaacaaccgtcttccaccggggccaaacccatgg
cccatcatcggaaacctccctcacatgggcactaagcctcatcgaaccctttccgccatg
gttactacttacggccctatcctccacctccgactagggttcgtagacgtcgtggtcgcc
gcttctaaatccgtggccgagcagttcttgaaaatacacgacgccaatttcgctagccga
ccaccaaactcaggagctaaacacatggcatataactatcaagatcttgtctttgcacct
tacggacaccgatggagactgttgagaaagattagttctgttcatctattttcagctaaa
gctctcgaagatttcaaacatgttcgacaggaagaggttggaacgctaacgcgggagcta
gtgcgtgttggcacgaaacccgtgaatttaggccagttggtgaacatgtgtgtagtcaac
gctctaggacgagagatgatcggacggcgattgttcggcgccgacgccgatcataaagct
gacgagtttcgatcaatggtgacggaaatgatggctctcgccggagtattcaacatcgga
gacttcgtgccgtcacttgattggttagatttacaaggcgtcgctggtaaaatgaaacgg
cttcacaagagattcgacgcttttctatcgtcgattttgaaagagcacgaaatgaacggt
caagatcaaaagcatacagatatgcttagcactttaatctcccttaaaggaactgatctt
gacggtgacggaggaagcttaacggatactgagattaaagccttgctattgaacatgttc
acagctggaactgacacgtcagcaagtacggtggactgggctatagctgaacttatccgt
cacccggatataatggttaaagcccaagaagaacttgatattgttgtgggccgtgacagg
cctgttaatgaatcagacatcgctcagcttccttaccttcaggcggttatcaaagagaat
ttcaggcttcatccaccaacaccactctcgttaccacacatcgcgtcagagagctgtgag
atcaacggctaccatatcccgaaaggatcgactctattgacgaacatatgggccatagcc
cgtgacccggatcaatggtccgacccgttagcatttaaacccgagagattcttacccggt
ggtgaaaaatccggcgttgatgtgaaaggaagcgatttcgagctaataccgttcggagct
gggaggagaatctgtgccggtttaagtttagggttacgtacgattcagtttcttacggcg
acgttggttcaaggatttgattgggaattagctggaggagttacgccggagaagctgaat
atggaggagagttatgggcttacactgcaaagagcggttcctttggtggtacatcctaag
ccaaggttggctccgaacgtttatggactcgggtcgggttaa

DBGET integrated database retrieval system