KEGG   Arabidopsis thaliana (thale cress): AT5G08300Help
Entry
AT5G08300         CDS       T00041                                 

Definition
(RefSeq) Succinyl-CoA ligase, alpha subunit
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00020  Citrate cycle (TCA cycle)
ath00640  Propanoate metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AT5G08300
   00640 Propanoate metabolism
    AT5G08300
Enzymes [BR:ath01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     AT5G08300
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     AT5G08300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 SseB
Motif
Other DBs
NCBI-GeneID: 830726
NCBI-ProteinID: NP_196447
MIPS: AT5G08300.1
TAIR: AT5G08300
Araport: AT5G08300
UniProt: P68209 A0A178U834
Position
5
AA seq 347 aa AA seqDB search
MSRQVARLIGSLSSKARRCSTGGSEVFPSCQSLTSLTQSRSFASDPHPPAAVFVDKNTRV
LCQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKADTKANASVI
YVPAPFAAAAIMEGIEAELDLIVCITEGIPQHDMVRVKHALNSQSKTRLIGPNCPGIIKP
GECKIGIMPGYIHKPGKIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVD
CLEKFFVDPQTEGIVLIGEIGGTAEEDAAALIKASGTEKPVVAFIAGLTAPPGRRMGHAG
AIVSGGKGTAQDKIKSLNDAGVKVVESPAKIGSAMYELFQERGLLKQ
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtctagacaagtggcaaggcttatcggatctctgtcatcaaaagctcgccgttgttct
accggcggctcagaggtttttccgtcatgccagtctctcacttcgttgacccaatctcgc
tccttcgcgtcggatcctcatcctcctgcggcggttttcgttgacaaaaacacacgagtc
ctctgtcaaggcatcaccggaaagaacggcactttccacactgaacaagccattgagtac
ggcaccaaaatggtggcaggagtgacaccgaagaagggtggaacagaacacttgggtctc
ccagttttcaactctgttgctgaagctaaggctgacaccaaagccaatgcctctgtgatt
tatgttcctgctccttttgctgctgctgctattatggagggtattgaggctgagttagat
cttattgtgtgtatcaccgaaggaatccctcaacatgacatggtacgtgtaaagcatgct
cttaacagtcaatcgaaaactaggctgattggtccaaactgccctgggattatcaagcct
ggtgaatgcaaaattggaattatgccgggatacatccacaagcctgggaagattggaatt
gtctcacgatctggaaccttgacatatgaagctgttttccaaacaactgcagtgggtcta
ggccaatctacttgtgtaggaatcggtggggatccttttaacgggacaaactttgtcgac
tgcttggagaaattctttgttgatcctcaaacagaaggtatcgttctcattggagaaatc
ggaggcactgcagaagaagatgctgcagcattgataaaggcaagtggtactgagaagcct
gttgttgcttttattgctggacttactgcaccaccgggtcgtcgaatgggtcatgccgga
gccattgtttccggtggtaaaggtacggctcaggacaaaattaagagtttgaatgatgct
ggagtgaaggttgttgaatctccggctaagattggatcagcgatgtatgagctctttcaa
gaaagaggtcttttgaagcagtga

DBGET integrated database retrieval system