KEGG   Arabidopsis thaliana (thale cress): AT5G08420Help
Entry
AT5G08420         CDS       T00041                                 

Definition
(RefSeq) RNA-binding KH domain-containing protein
  KO
K06961  ribosomal RNA assembly protein
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ath03009]
    AT5G08420
Ribosome biogenesis [BR:ath03009]
 Eukaryotic type
  90S particles
   Other 90S particles
    AT5G08420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: KH_8
Motif
Other DBs
NCBI-GeneID: 830741
NCBI-ProteinID: NP_196459
MIPS: AT5G08420.1
TAIR: AT5G08420
Araport: AT5G08420
UniProt: Q9FT93 A0A178UIZ9
Position
5
AA seq 391 aa AA seqDB search
MAEVEEIAHEEQNIEKREKKKGKHEKPKPWDDDPNIDRWTIEKFDPAWNPTGMTETSTFS
TLFPQYREKYLQECWPRVESALKEYGVACKLNLVEGSMTVSTTRKTRDPYIIVKARDLIK
LLSRSVPAPQAIKILEDEVQCDIIKIGNLVRNKERFVKRRQRLVGPNSSTLKALEILTNC
YILVQGSTVAAMGPFKGLKQLRRIVEDCVQNIMHPVYHIKTLMMKKELEKDPALANESWD
RFLPTFRKKNVKQKKPKSKEKKPYTPFPPPQPPSKIDMQLESGEYFMSDKKKSEKKWQEK
QEKQSEKSTENKRKRDASFLPPEEPMNNNSNANKSEDGKNDITELTNSLKSKTKELKKQK
KTHERVNAEEYIAGPSSSADKSSKKSKKIRD
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggtggaggagattgcgcacgaggagcagaatatcgagaagagggagaagaag
aaaggtaaacacgagaagccgaagccatgggatgatgacccaaacatcgaccgttggaca
atcgagaagtttgatccggcatggaaccccactggtatgactgaaaccagcacgttctca
acactctttcctcaatacagagagaagtatcttcaggagtgttggcctagagttgaatct
gctcttaaggagtacggtgtcgcctgcaagctcaacttggttgaaggttctatgactgtt
tcgacgacgaggaagacaagagatccatacatcattgtcaaagctagggatttgattaag
cttctttccagaagtgtccctgctcctcaggcaattaagattctcgaagatgaggtgcaa
tgtgatatcatcaagatcggtaacttggttagaaataaggaaagatttgttaaaagaagg
cagcggcttgtgggtcctaattcttctaccttgaaggcgctggaaatattaaccaactgt
tacattctagttcagggaagtactgtagccgctatgggtccatttaaaggtctcaaacag
ctcagaaggattgtggaagactgcgtacagaatataatgcatcctgtataccatataaag
actctcatgatgaaaaaagaactggagaaggatccagctcttgcaaatgaaagctgggat
aggtttcttcccacattcaggaagaaaaatgttaagcaaaagaaacccaaaagcaaggag
aagaagccatacacacctttcccacctcctcaaccacctagcaagattgatatgcagttg
gagtctggagaatacttcatgagtgataaaaagaagtcagagaaaaaatggcaggagaag
caagagaaacagtcagagaagagcacagagaacaaaagaaagagagatgcctcattcctc
ccacctgaggagcctatgaacaacaatagcaacgcaaacaaatcagaggatggaaagaat
gatataaccgagttaacaaattccttgaagagcaagacgaaggagttgaaaaagcagaaa
aagacacacgagagagtgaatgcggaggagtatattgctggtccatcttcttctgctgat
aaatcttccaagaagtccaaaaagattagagattaa

DBGET integrated database retrieval system