KEGG   Arabidopsis thaliana (thale cress): AT5G08490Help
Entry
AT5G08490         CDS       T00041                                 

Gene name
SLG1
Definition
(RefSeq) Tetratricopeptide repeat (TPR)-like superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: PPR_2 PPR PPR_1 PPR_3 PPR_long ATP13 Popeye DYW_deaminase TPR_7
Motif
Other DBs
NCBI-GeneID: 830748
NCBI-ProteinID: NP_001318512
MIPS: AT5G08490.1
TAIR: AT5G08490
Araport: AT5G08490
UniProt: Q9FNN9
Position
5
AA seq 849 aa AA seqDB search
MGPLRQFVQNFRLLSGFGTDHRVFLDVVKACASVSDLTSGRALHGCVFKLGHIACSEVSK
SVLNMYAKCRRMDDCQKMFRQMDSLDPVVWNIVLTGLSVSCGRETMRFFKAMHFADEPKP
SSVTFAIVLPLCVRLGDSYNGKSMHSYIIKAGLEKDTLVGNALVSMYAKFGFIFPDAYTA
FDGIADKDVVSWNAIIAGFSENNMMADAFRSFCLMLKEPTEPNYATIANVLPVCASMDKN
IACRSGRQIHSYVVQRSWLQTHVFVCNSLVSFYLRVGRIEEAASLFTRMGSKDLVSWNVV
IAGYASNCEWFKAFQLFHNLVHKGDVSPDSVTIISILPVCAQLTDLASGKEIHSYILRHS
YLLEDTSVGNALISFYARFGDTSAAYWAFSLMSTKDIISWNAILDAFADSPKQFQFLNLL
HHLLNEAITLDSVTILSLLKFCINVQGIGKVKEVHGYSVKAGLLHDEEEPKLGNALLDAY
AKCGNVEYAHKIFLGLSERRTLVSYNSLLSGYVNSGSHDDAQMLFTEMSTTDLTTWSLMV
RIYAESCCPNEAIGVFREIQARGMRPNTVTIMNLLPVCAQLASLHLVRQCHGYIIRGGLG
DIRLKGTLLDVYAKCGSLKHAYSVFQSDARRDLVMFTAMVAGYAVHGRGKEALMIYSHMT
ESNIKPDHVFITTMLTACCHAGLIQDGLQIYDSIRTVHGMKPTMEQYACAVDLIARGGRL
DDAYSFVTQMPVEPNANIWGTLLRACTTYNRMDLGHSVANHLLQAESDDTGNHVLISNMY
AADAKWEGVMELRNLMKKKEMKKPAGCSWLEVDGQRNVFVSGDCSHPRRDSIFDLVNALY
LQMKEPVVF
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atgggccctttacggcaatttgttcagaatttcagacttttgtctggttttggaactgat
cacagggtttttctggatgttgtcaaagcttgtgcttcagtgtctgatctcacatcaggg
agggctctgcacggttgcgtgttcaagcttggtcatatagcctgctctgaggtttcgaag
tcagttcttaacatgtatgcgaaatgcaggagaatggatgattgccagaagatgtttagg
caaatggacagtcttgatcctgttgtttggaatattgttctgactggactttctgtttct
tgcggtcgtgaaacgatgaggtttttcaaagcaatgcactttgcagatgaacctaagccg
agctctgttacctttgcgattgttcttcctttgtgtgttcgccttggggattcatacaat
gggaagagtatgcattcttatattattaaagccggtttggagaaagatacacttgtgggg
aatgctttggtttccatgtatgccaaatttggttttatttttcccgatgcttatactgca
tttgatggtatagctgataaagatgttgtctcttggaatgcgattattgctgggttttct
gagaataatatgatggctgatgcatttagatcgttttgtctaatgctgaaggaacctaca
gagccaaattatgcaacaattgcaaatgttttgcctgtttgcgcttctatggacaagaac
attgcatgtcgaagtggtagacagattcacagttatgttgtgcagaggtcttggctgcaa
acccatgtttttgtatgtaattcacttgttagtttctatttgagagtcggaaggatagaa
gaagcagcctcattgtttaccaggatgggttctaaagatctagtttcatggaatgttgtc
atagctggttatgcatcaaattgtgagtggtttaaagcatttcagttatttcacaacttg
gtgcataagggggatgtttctcctgattcggtaactattatcagtatccttcctgtctgt
gcgcaattaactgacttggcctctgggaaagagatccacagttatatattgcgccattct
taccttttggaggatacatcagttgggaatgctctcattagtttctatgcaagatttggt
gacacaagtgcagcatattgggccttttcactgatgtccacgaaggatataatatcttgg
aatgctatacttgatgcctttgcagacagtccaaagcagtttcaatttttgaatctcttg
caccacttacttaatgaagcaatcactcttgactctgttactattttaagcctactaaag
ttttgcataaatgtacagggaattggtaaagtaaaagaagttcatgggtactcagttaag
gctggtcttttacacgatgaagaggaacccaagcttggcaatgcattgcttgatgcatat
gccaaatgtggtaatgttgaatacgctcataagatttttctgggtttatcagagaggaga
actttggtttcctataactcattgttatcaggatatgttaatagtggaagtcatgatgat
gctcagatgctcttcactgagatgtctactactgatctcaccacttggagtttgatggtt
cgtatctatgctgaaagttgttgccctaatgaagccattggtgttttccgtgagattcaa
gctcgaggaatgaggcctaacactgtgactatcatgaatctccttcctgtttgtgcgcag
ctagcctctctgcatctagtaagacaatgtcatggatatattattagaggcggacttggt
gatatccgcctgaaggggactctactagatgtatatgctaaatgtggcagcttgaagcat
gcatattctgtcttccagtcagatgctcgtagagatctggttatgttcactgctatggta
gctgggtatgctgtacatggtaggggcaaggaagcacttatgatctactctcatatgact
gaatcaaacataaagcccgatcatgttttcataactactatgttgactgcatgctgtcat
gcagggttaatacaggatggattgcaaatatatgactcaataaggacagttcacggtatg
aaacctacaatggaacaatatgcttgtgctgtagatctaattgctcgagggggtcgactt
gatgatgcatattcttttgtcacacagatgccagttgaacctaatgcaaatatatgggga
acactgttaagggcgtgtacaacctataataggatggatctggggcactcagttgcaaat
catctcttgcaagctgaatctgacgacaccggaaaccacgttctaatatcgaatatgtat
gctgcagatgctaaatgggaaggcgtgatggagttgagaaacctaatgaagaaaaaggaa
atgaaaaagccagcgggatgtagctggctagaagtggatgggcaaaggaatgtctttgtg
tctggagattgttctcaccctcgtagagacagtatttttgacttagtaaatgctttatat
cttcagatgaaagagcctgtggtgttttaa

DBGET integrated database retrieval system