KEGG   Arabidopsis thaliana (thale cress): AT5G08680Help
Entry
AT5G08680         CDS       T00041                                 

Definition
(RefSeq) ATP synthase alpha/beta family protein
  KO
K02133  F-type H+-transporting ATPase subunit beta [EC:7.1.2.2]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00190  Oxidative phosphorylation
ath01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AT5G08680
Enzymes [BR:ath01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     AT5G08680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-synt_ab Synthase_beta ATP-synt_ab_N AAA NB-ARC AAA_16 ATPase T3SS_ATPase_C RsgA_GTPase NACHT ATPase_2 AAA_19
Motif
Other DBs
NCBI-GeneID: 830769
NCBI-ProteinID: NP_680155
MIPS: AT5G08680.1
TAIR: AT5G08680
Araport: AT5G08680
UniProt: Q9C5A9
Position
5
AA seq 559 aa AA seqDB search
MASRRILSSLLRSSSSRSTSKSSLIGSRNPRLLSPGPAHGAAPCGTLLGRVAEYSTSSPA
NSAAPSSAPAKDEGKKTYDYGGKGAIGRVCQVIGAIVDVRFEDQEGLPPIMTSLEVQDHP
TRLVLEVSHHLGQNVVRTIAMDGTEGLVRGRKVLNTGAPITVPVGRATLGRIMNVLGEPI
DERGEIKTEHYLPIHRDAPALVDLATGQEILATGIKVVDLLAPYQRGGKIGLFGGAGVGK
TVLIMELINNVAKAHGGFSVFAGVGERTREGNDLYREMIESGVIKLGEKQSESKCALVYG
QMNEPPGARARVGLTGLTVAEYFRDAEGQDVLLFIDNIFRFTQANSEVSALLGRIPSAVG
YQPTLASDLGALQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRQIS
ELGIYPAVDPLDSTSRMLSPHILGEEHYNTARGVQKVLQNYKNLQDIIAILGMDELSEDD
KLTVARARKIQRFLSQPFHVAEIFTGAPGKYVDLKENINSFQGLLDGKYDDLSEQSFYMV
GGIDEVVAKAEKIAKESAA
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtcggcgaatcttatcatcgcttctccgttcttcttcgagtagatctacttct
aaatcctccttgatcgggagccgaaacccgaggcttttatcccccggtcccgcgcatgga
gccgctccatgtgggactctccttggccgagtcgccgagtattcgacttcttctccggct
aattcggctgcaccatcttctgctcctgctaaagatgagggaaagaagacctatgattac
ggtggcaaaggcgcgatcgggcgtgtgtgtcaggttattggtgccattgttgatgtgaga
ttcgaagatcaggagggattgcctccgatcatgacatctctcgaggtacaggatcatcca
acaaggttggtccttgaggtgtctcatcacttgggtcaaaatgtcgttaggaccattgct
atggatggtactgagggtctcgtccgtggaaggaaggttctcaacactggtgctccaatc
actgttcctgttggaagggccacccttggacgtatcatgaacgttcttggagaacctatt
gacgagagaggcgaaattaagaccgagcattacttacccattcacagagacgctccagct
ttggttgatttggccaccggtcaagagattctcgctactggtattaaggttgttgatctc
cttgctccttaccaaagaggaggaaagattgggctttttggcggtgctggtgttgggaaa
acagtgctcattatggaactgattaacaatgttgccaaagctcatggtggtttctccgtg
tttgctggtgtgggagaacggacccgtgaaggcaatgatttgtacagagaaatgattgag
agtggtgtcatcaagctaggagagaaacagtctgagagcaaatgtgccctagtgtatgga
caaatgaatgagcccccgggtgctcgtgcccgtgttggactgactggtttgactgttgct
gagtatttccgtgatgctgaaggccaagatgtcttgcttttcattgacaacatcttccgt
ttcacccaggccaactctgaagtgtctgcgttgctcggtcgtatcccgtctgctgtgggg
taccagccaactctggcttccgatcttggtgctcttcaagagcgaatcacaaccaccaag
aaaggttcaattacctctgtccaagccatctatgtccctgctgatgatttgacagatcct
gctcctgccacaacttttgctcacttggatgccacaactgtgctttcaagacagatttct
gagcttggtatctaccctgctgtggatcctttggattcgacgtcccgtatgctctcgccc
cacattctaggtgaggagcactacaacacagctcgtggtgtgcagaaagtgttgcagaat
tacaagaatttgcaagatattatcgccattttgggaatggatgagctaagtgaagatgac
aagctgactgttgcccgtgcccgtaagatccagagattcttgagtcagccattccatgtt
gctgaaatcttcactggtgcccctggaaaatatgtcgaccttaaagaaaacatcaacagt
ttccagggtttgttggatggcaagtacgatgatctttccgaacaatcgttttacatggtt
ggaggtatcgatgaggtggttgcaaaggcagagaagatcgctaaagagtcagcagcttag

DBGET integrated database retrieval system