KEGG   Arabidopsis thaliana (thale cress): AT5G09810
Entry
AT5G09810         CDS       T00041                                 

Gene name
ACT7
Definition
(RefSeq) actin 7
  KO
K10355  actin, other eukaryote
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ath04812]
    AT5G09810 (ACT7)
Cytoskeleton proteins [BR:ath04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     AT5G09810 (ACT7)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 830841
NCBI-ProteinID: NP_196543
MIPS: AT5G09810.1
TAIR: AT5G09810
UniProt: P53492 A0A178UEW4
Position
5
AA seq 377 aa
MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
DLAGRDLTDSLMKILTERGYMFTTTAEREIVRDIKEKLAYVALDYEQELETAKSSSSVEK
NYELPDGQVITIGAERFRCPEVLFQPSLIGMEAPGIHETTYNSIMKCDVDIRKDLYGNIV
LSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIS
KSEYDESGPSIVHRKCF
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggccgatggtgaggatattcagccacttgtctgtgacaatggaactggaatggtgaag
gctggttttgctggtgatgatgccccgagagcagtgttcccaagtattgttggtcgtcct
aggcacactggtgtcatggttggtatgggtcagaaagatgcttacgttggtgatgaagct
cagtccaagagaggtatcctcactctgaagtatccaatcgaacatggtattgtaagtaac
tgggatgacatggaaaagatatggcatcacactttctacaacgagcttcgtgttgcccct
gaggagcacccagttctactcacagaggcacctcttaaccctaaagctaacagggagaag
atgactcagatcatgtttgagacattcaatgtccctgccatgtatgttgccattcaggcc
gttctttctctctatgccagtggtcgtacaaccggtattgtgctcgattctggtgatggt
gtgtctcacactgtgccaatctacgaggggtatgctcttcctcatgctatccttcgtctt
gatcttgcgggtcgggatctcacagactcactcatgaagattctcactgagagaggttac
atgttcaccactaccgcagaacgggaaattgtccgtgacataaaggagaaacttgcttat
gtcgctcttgactacgagcaagagctagagacagccaagagcagttcttcagtggagaag
aactacgagctacctgatggacaagtcataaccatcggagctgagagattccgttgtcct
gaggttctgttccagccatcgctcatcggaatggaagctcctggaatccatgaaacaact
tacaactccatcatgaaatgtgatgtcgatatcaggaaggatctctatggaaacatcgtt
ctcagtggtggttccaccatgttcccaggaattgctgaccgtatgagcaaagagatcacc
gctcttgcacctagcagcatgaagatcaaggtggttgcaccgccagagagaaaatacagt
gtctggatcggaggatcaatccttgcatccctcagcaccttccaacagatgtggatttca
aagagtgagtacgatgagtcaggtccatcgattgttcacaggaaatgcttctaa

DBGET integrated database retrieval system