KEGG   Arabidopsis thaliana (thale cress): AT5G10160
Entry
AT5G10160         CDS       T00041                                 
Name
(RefSeq) Thioesterase superfamily protein
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00061  Fatty acid biosynthesis
ath00780  Biotin metabolism
ath01100  Metabolic pathways
ath01212  Fatty acid metabolism
ath01240  Biosynthesis of cofactors
Module
ath_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AT5G10160
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AT5G10160
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ath01004]
    AT5G10160
Enzymes [BR:ath01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     AT5G10160
Lipid biosynthesis proteins [BR:ath01004]
 Fatty acid synthase
  Component type
   AT5G10160
SSDB
Motif
Pfam: FabA MaoC_dehydratas MaoC_dehydrat_N 4HBT
Other DBs
NCBI-GeneID: 830880
NCBI-ProteinID: NP_196578
TAIR: AT5G10160
UniProt: Q9LX13 A0A178USI4
Position
5:3185734..3187312
AA seq 219 aa
MAASSSVFTVSPSRNLAAIPLHQSLSPPLLRSSSVAFRPKRRSSSLVLCSTDESKSTAEK
EIPIELRYEAFPTVMDINKIQEILPHRFPFLLVDRVIEYTAGVSAVAIKNVTINDNFFPG
HFPERPIMPGVLMVEAMAQVGGIVMLQPEVGGSRSNFFFAGIDKVRFRKPVIAGDTLVMR
MTLVKLQKRFGIAKMEGKAYVGNSVVCEGEFLMAMGKEE
NT seq 660 nt   +upstreamnt  +downstreamnt
atggctgcttcaagctccgttttcacagtatccccgtcgcgaaatcttgcagctattcct
cttcatcagtccctatctccaccgttgcttagatccagctccgtcgcgtttcgtcccaaa
cgaagatccagctcactcgtcttatgctcaactgatgaatcaaagagcaccgcagagaaa
gagatcccaatcgaactaaggtatgaggcgtttccgacagtgatggacatcaataagata
caagagattttgcctcacagattcccatttctgttagttgatagagtgatagagtacaca
gctggtgtatctgcggtagctattaaaaacgttaccattaatgacaatttctttcctggg
catttccctgagagacctataatgcctggagttctcatggttgaggcaatggctcaagtg
ggaggtatagtgatgctacaaccagaagttggcggatctagaagcaacttcttctttgct
ggaatcgacaaagtcagattcaggaagccagtgattgcaggtgatacgctggtgatgagg
atgacacttgtgaagttgcagaagcggtttgggatagcgaaaatggaagggaaagcatat
gtagggaactctgtggtatgtgaaggagagttcttgatggctatgggaaaagaagagtga

DBGET integrated database retrieval system