KEGG   Arabidopsis thaliana (thale cress): AT5G10540
Entry
AT5G10540         CDS       T00041                                 
Name
(RefSeq) Zincin-like metalloproteases family protein
  KO
K01414  oligopeptidase A [EC:3.4.24.70]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ath01002]
    AT5G10540
Enzymes [BR:ath01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.70  oligopeptidase A
     AT5G10540
Peptidases and inhibitors [BR:ath01002]
 Metallo peptidases
  Family M3
   AT5G10540
SSDB
Motif
Pfam: Peptidase_M3 TOP_N Peptidase_M50B 120_Rick_ant DUF6055 FUSC-like
Other DBs
NCBI-GeneID: 830919
NCBI-ProteinID: NP_568232
TAIR: AT5G10540
UniProt: Q949P2 A0A178UD97
Structure
Position
5:3324812..3334971
AA seq 701 aa
MASEDTLSSNPLLQNFDFPPFDSVDAHHVRPGIRALLQQLEAELEQLEKAVEPSWPKLVE
PLEKIIDRLSVVWGMINHLKAVKDTPELRAAIEEVQPEKVKFQLRLGQSKPIYNAFKAIR
ESPDWNSLSEARQRLVEAQIKEAVLSGIALEDDKREEFNKIEQELEKLSHKFSENVLDAT
KKFEKLITDKKEIEGLPPSALGLFAQAAVSKGHETATADTGPWLITLDAPSYLPVMQHAK
NRALREEVYRAYLSRASSGDLDNTAIIDQILKLRLEKAKLLGYRNYAEVSMATKMATVEK
ADELLEKLRSASWDPAVQDIEDLKSFAKNQGAAEADSLTHWDITFWSERLRESKYDINEE
ELRPYFSLPKVMDALFGLAKTLFGIDVVPADGVAPVWNSDVRFYCVKDSSGNPTAYFYFD
PYSRPSEKRDGAWMDEVFSRSRVMAQKGSSVRLPVAQMVCNQTPPVGDKPSLMTFREVET
VFHEFGHALQHMLTKEDEGLVAGIRNIEWDAVELPSQFMENWCYHRDTLMSIAKHYQTGE
TLPENVYKKLLAARTFRAGSLSLRQLKFATVDLELHTKYMPGGAETIYEVDQRVSIKTQV
IPPLPEDRFLCSFSHIFAGGYAAGYYSYKWAEVLSADAFSAFEDAGLDDIKAVKETGQRF
RNTILALGGGKAPLKVFVEFRGREPSPEPLLRHNGLLAASA
NT seq 2106 nt   +upstreamnt  +downstreamnt
atggcttctgaagatactctctcctcgaatcctctattgcagaattttgacttccctccg
tttgactccgttgatgctcaccatgtcagacctgggattcgtgctctgttgcagcagctc
gaagctgaattggagcagctagaaaaagctgtagagccttcatggccaaaactagtggag
ccattagagaagattattgatcggttatctgttgtttggggaatgatcaatcatcttaag
gctgtcaaggacacacctgagcttcgtgctgccattgaagaagttcagccggagaaggtg
aagttccagctcaggttgggacagagcaaacccatttacaatgcatttaaggctattcga
gaatctccagactggaattcattgagcgaagctcgtcaacgattagttgaagcccaaata
aaggaggcggttctgagtggtattgctcttgaagatgataagagggaagaatttaacaaa
attgaacaggaacttgaaaaactttctcataagttttctgagaatgttttggacgctaca
aagaagtttgaaaagttgataacagacaagaaagagattgaggggttgccaccatctgca
cttggattgttcgcacaagcagctgtttccaagggccatgaaactgcaactgctgacact
ggaccatggctcattacactcgatgctcctagttatcttcccgttatgcaacatgccaaa
aaccgagctctgcgcgaggaagtctaccgtgcttacttatcccgtgcctcttcgggtgat
ttagataatacagcaattatcgaccaaatcttgaagcttcgactggaaaaggctaagctt
cttggttacagaaattatgctgaggtaagcatggccacgaaaatggctactgtggagaaa
gcagatgagctactagaaaagcttcgcagtgcttcatgggatccggctgttcaagacata
gaagaccttaagagttttgcgaagaaccaaggtgctgcagaggctgacagtttgactcac
tgggacatcactttctggagtgagaggcttcgtgaatccaaatacgatattaatgaggaa
gaactgcgaccttacttctcattgccaaaggttatggatgcgttattcggtctagctaag
acactatttggaattgatgttgtgccagcagacggtgtagcgccggtctggaacagcgat
gttaggttctactgtgtcaaagattcttctggaaatccaactgcttatttctactttgat
ccctactctcgcccttcagaaaagagagacggcgcttggatggatgaagttttttctcgt
agccgagtcatggcccagaagggttcctccgttagactccctgttgctcaaatggtctgc
aaccaaactccacctgttggtgacaagccaagccttatgacattccgtgaggtagagact
gtgttccatgaatttggccatgctcttcagcatatgcttaccaaagaggatgaggggcta
gtggctggtatccggaatatcgagtgggatgcagttgaattaccgtcacagtttatggag
aactggtgctaccacagggataccttaatgagcattgctaagcattatcaaacaggagaa
actcttcccgagaatgtatacaagaagctactggctgcaagaacattccgtgcagggtcc
cttagtcttcgccagttgaagtttgctacagttgatctggagctgcacacaaaatacatg
ccaggtggggcagagaccatctacgaagttgatcaaagggtgtccataaaaacacaagtg
atccctccacttcctgaagatagattcctctgtagcttcagtcatatatttgcaggtggt
tatgcagctggatactacagttacaagtgggcggaggttttgtctgcagatgcgttttca
gcttttgaagatgctgggttggatgacattaaggctgtcaaagaaacaggacagagattc
agaaacactatacttgctctgggaggaggaaaagctcctctaaaagtgtttgtggagttc
agaggacgagaaccttccccagagcctctgctcagacacaatggactcttggctgcttct
gcttga

DBGET integrated database retrieval system