KEGG   Arabidopsis thaliana (thale cress): AT5G11060Help
Entry
AT5G11060         CDS       T00041                                 

Gene name
KNAT4
Definition
(RefSeq) homeobox protein knotted-1-like 4
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: KNOX2 Homeobox_KN KNOX1 ELK Homeobox
Motif
Other DBs
NCBI-GeneID: 830973
NCBI-ProteinID: NP_196667
MIPS: AT5G11060.1
TAIR: AT5G11060
Araport: AT5G11060
UniProt: P48001 A0A178UC59
Position
5
AA seq 393 aa AA seqDB search
MAFHNNHFNHFTDQQQHQPPPPPQQQQQQHFQESAPPNWLLRSDNNFLNLHTAASAAATS
SDSPSSAAANQWLSRSSSFLQRGNTANNNNNETSGDVIEDVPGGEESMIGEKKEAERWQN
ARHKAEILSHPLYEQLLSAHVACLRIATPVDQLPRIDAQLAQSQNVVAKYSTLEAAQGLL
AGDDKELDHFMTHYVLLLCSFKEQLQQHVRVHAMEAVMACWEIEQSLQSFTGVSPGEGTG
ATMSEDEDEQVESDAHLFDGSLDGLGFGPLVPTESERSLMERVRQELKHELKQGYKEKIV
DIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFI
NQRKRNWHSNPSSSTVSKNKRRSNAGENSGRDR
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttcataacaatcactttaatcatttcaccgaccaacaacaacatcagcctcct
cctccgccgcaacagcagcagcaacaacattttcaagaatcagcaccccctaattggctc
ctccgctccgacaacaacttcctcaatctccacacagctgcctctgccgccgctacaagc
tccgattctccttcttccgccgccgctaaccagtggctctcacgatcctcatccttcctc
caacgaggcaacaccgcaaacaacaacaacaacgaaacatccggtgacgtcatcgaagac
gttcccggcggagaggagtcaatgatcggagagaagaaggaggcggagaggtggcagaat
gcgagacacaaggcggagatactgtctcatccactatacgagcaacttttgtcggcacac
gtggcgtgcctgaggatcgcaacgccggtggatcagcttccgaggatagacgcacagctt
gctcagtctcaaaacgtcgtggctaagtactcaactttagaagccgctcaaggactcctc
gccggcgatgacaaggagcttgaccacttcatgacgcattatgtactattgctttgctct
ttcaaagaacaactgcaacagcatgttcgtgttcatgcaatggaagctgttatggcctgt
tgggagattgaacagtcgcttcaaagttttacaggggtatctcctggtgaaggcacagga
gcaacaatgtctgaggatgaagatgagcaagtagagagtgatgctcatttgtttgatgga
agcttagatgggttagggtttggtcctctagttcccactgagagcgagagatctttgatg
gaacgagtcagacaagaactcaaacatgaactcaagcagggttacaaggagaaaattgtg
gacataagagaggagatactgaggaagagaagagctggaaaattaccaggagacaccacc
tctgttctcaaatcatggtggcaatctcattctaagtggccttaccctactgaggaagat
aaggcgaggttggtgcaggagacgggtttgcagctcaaacagataaacaattggttcatc
aatcaaagaaagaggaattggcatagcaatccatcttcttctaccgtctcaaagaataaa
cgccgaagcaatgcaggtgaaaacagcggaagagaccgttga

DBGET integrated database retrieval system