KEGG   Arabidopsis thaliana (thale cress): AT5G11920Help
Entry
AT5G11920         CDS       T00041                                 

Gene name
cwINV6
Definition
(RefSeq) 6-&1-fructan exohydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00052  Galactose metabolism
ath00500  Starch and sucrose metabolism
ath01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AT5G11920 (cwINV6)
   00500 Starch and sucrose metabolism
    AT5G11920 (cwINV6)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     AT5G11920 (cwINV6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 831065
NCBI-ProteinID: NP_568254
MIPS: AT5G11920.1
TAIR: AT5G11920
Araport: AT5G11920
UniProt: Q8W4S6
Position
5
AA seq 550 aa AA seqDB search
MADVMEQNLLQTAVLNRTSFHFQPQRNWLNDPNAPMYYKGFYHLFYQNNPLAPEFSRTRI
IWGHSVSQDMVNWIQLEPALVPSESFDINSCWSGSATILPDGRPVILYTGLDVNNKQQVT
VVAEPKDVSDPLLREWVKPKYNPVMVPPSNVPFNCFRDPTEAWKGQDGKWRVLIGAKEKD
TEKGMAILYRSDDFVQWTKYPVPLLESEGTGMWECPDFFPVSITGKEGVDTSVNNASVRH
VLKASFGGNDCYVIGKYSSETEDFSADYEFTNTSADLRYDHGTFYASKAFFDSVKNRRIN
WGWVIETDSKEDDFKKGWAGLMTLPREIWMDTSGKKLMQWPIEEINNLRTKSVSLDDCYE
FKTGSTFEISGITAAQADVEVTFNLPFLENNPEILDADQVDDATLFDRDSSVGCVYGPFG
LLALASSDLSEQTAIFFKVIRRGNGYAVVMCSSEKRSSLRDNIKKSSHGAFLDIDPRHEK
ISLRCLIDHSIIESYGVGGKTVITSRVYPKLAIGEAAKLYVFNDGENGVIMTSLEAWSMR
NAQINSNPTY
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgtaatggaacagaatcttcttcaaaccgctgtgcttaaccggacgtccttc
catttccaacctcagagaaattggctcaacgatccaaacgcgccaatgtattacaaagga
ttctaccatttgttctaccagaataaccctttggctcccgaattcagtaggacaagaatc
atatggggacactctgtttcacaagacatggtcaattggatccagctcgaaccagccctt
gtcccttctgagtcctttgacatcaacagctgctggtcaggatccgccacgatcctccct
gatggcagacctgtaattttgtacactggactcgacgtcaacaacaaacagcaagtcaca
gttgttgccgaaccaaaggacgtttctgaccctttgcttcgtgagtgggttaagccaaag
tacaatcctgtgatggttccgccaagtaatgtcccttttaattgtttccgtgatcccacg
gaggcgtggaaagggcaagatgggaaatggagagtgctcataggagctaaggagaaagat
actgagaaaggaatggcgattttgtaccgaagcgatgattttgtccagtggacaaagtat
ccggtgcctttacttgagtcagaaggaaccggaatgtgggaatgccctgattttttcccg
gtttctatcactggtaaagaaggtgttgacacttcggtaaacaatgctagtgtgaggcat
gtcttgaaggcgagttttggaggcaatgattgctatgtcattggtaaatactcttctgag
actgaagacttttcagcggattatgagttcactaacactagtgcagatttgagatatgat
catggaacgttttatgcctcaaaggcgttcttcgatagtgttaaaaataggaggatcaac
tggggatgggtcatagagactgatagcaaagaagatgattttaagaaaggatgggctggc
cttatgactcttcccagggaaatttggatggacacaagtggaaagaagctgatgcaatgg
ccaattgaagaaatcaacaatctccggaccaaaagtgttagccttgatgattgctatgaa
ttcaaaaccggctctacctttgaaatctcaggcatcactgctgcccaagcagatgtagaa
gtgacttttaatctgcctttcctggaaaataatcccgagatacttgatgctgaccaagtt
gatgatgcgactctgtttgatcgtgatagctcggttggatgtgtttacgggccttttgga
ttgctagcattggcttccagtgatttatcagaacaaaccgcaatcttctttaaagttatt
cgtcgcggtaacggatatgcagttgtaatgtgcagcagcgagaagaggtcttcgttgaga
gacaacataaaaaaatcttcgcatggagcattcctagatattgatccaaggcatgagaag
atctcattaagatgtttgatcgatcactcgattatagagagctacggagtaggaggaaaa
actgtgataacatctagagtttatccaaaattggcaattggtgaagccgctaagctttat
gtcttcaatgatggagaaaatggtgtgatcatgacgtccctggaagcttggagcatgaga
aatgcccaaatcaattcaaacccaacttattag

DBGET integrated database retrieval system