KEGG   Arabidopsis thaliana (thale cress): AT5G13010Help
Entry
AT5G13010         CDS       T00041                                 

Gene name
EMB3011
Definition
(RefSeq) RNA helicase family protein
  KO
K12815  pre-mRNA-splicing factor ATP-dependent RNA helicase DHX38/PRP16 [EC:3.6.4.13]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    AT5G13010 (EMB3011)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ath03041]
    AT5G13010 (EMB3011)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     AT5G13010 (EMB3011)
Spliceosome [BR:ath03041]
 Complex C
  Other components
   Step II factors
    AT5G13010 (EMB3011)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD DUF2075 AAA_22 AAA_30 T2SSE AAA_19 Flavi_DEAD AAA_24 AAA_33 ATPase AAA_14 AAA_7 SRP54 ABC_tran
Motif
Other DBs
NCBI-GeneID: 831141
NCBI-ProteinID: NP_196805
MIPS: AT5G13010.1
TAIR: AT5G13010
Araport: AT5G13010
UniProt: F4K2E9
Position
5
AA seq 1255 aa AA seqDB search
MGVDPFKTTETLEADKETNGGVPVKDKLTFKAPERKSRLGLDARAIEKKDNAKTEGEFKV
PKKSAISVTSSLDEEDKSDVSGLDFGTENTRPVHSSRRYREKSSRSQSAQESTVTTENAG
TSDISITPRTLSCTSSYERGGSNRHREEHRRDRSETPRSRQRNTYDEMDHYRRRESYRQS
DRDYHGEKRRRYNSDWRTPGRSDWDDGQDEWERSPHGDRGSSYSRRPQPSPSPMLAAASP
DARLASPWLDTPRSTMSSASPWDMGAPSPIPIRASGSSIRSSSSRYGGRSNQLAYSREGD
LTNEGHSDEDRSQGAEEFKHEITETMRVEMEYQSDRAWYDTDEGNSLFDADSASFFLGDD
ASLQKKETELAKRLVRRDGSKMSLAQSKKYSQLNADNAQWEDRQLLRSGAVRGTEVQTEF
DSEEERKAILLVHDTKPPFLDGRVVYTKQAEPVMPVKDPTSDMAIISRKGSGLVKEIREK
QSANKSRQRFWELAGSNLGNILGIEKSAEQIDADTAVVGDDGEVDFKGEAKFAQHMKKGE
AVSEFAMSKTMAEQRQYLPIFSVRDELLQVIRENQVIVVVGETGSGKTTQLTQYLHEDGY
TINGIVGCTQPRRVAAMSVAKRVSEEMETELGDKIGYAIRFEDVTGPNTVIKYMTDGVLL
RETLKDSDLDKYRVVVMDEAHERSLNTDVLFGILKKVVARRRDFKLIVTSATLNAQKFSN
FFGSVPIFNIPGRTFPVNILYSKTPCEDYVEAAVKQAMTIHITSPPGDILIFMTGQDEIE
AACFSLKERMEQLVSSSSREITNLLILPIYSQLPADLQAKIFQKPEDGARKCIVATNIAE
TSLTVDGIYYVIDTGYGKMKVFNPRMGMDALQVFPISRAASDQRAGRAGRTGPGTCYRLY
TESAYLNEMLPSPVPEIQRTNLGNVVLLLKSLKIDNLLDFDFMDPPPQENILNSMYQLWV
LGALNNVGGLTDLGWKMVEFPLDPPLAKMLLMGERLDCIDEVLTIVSMLSVPSVFFRPKE
RAEESDAAREKFFVPESDHLTLLNVYQQWKEHDYRGDWCNDHYLQVKGLRKAREVRSQLL
DILKQLKIELRSCGPDWDIVRKAICSAYFHNSARLKGVGEYVNCRTGMPCHLHPSSALYG
LGYTPDYVVYHELILTTKEYMQCATSVEPHWLAELGPMFFSVKDSDTSMLEHKKKQKEEK
SGMEEEMEKLRRDQVESELRSKERERKKRAKQQQQISGPGLKKGTTFLRPKKLGL
NT seq 3768 nt NT seq  +upstreamnt  +downstreamnt
atgggggttgatccattcaaaactacggaaacgttagaagccgacaaggaaaccaatggt
ggtgtccctgtgaaggataaattgacttttaaagctcctgagagaaagtcccgtttaggt
ttggatgcaagggcaattgagaaaaaggataatgccaagactgagggcgagtttaaggtt
ccgaagaagtcagcaatatctgttacatcatcgttggatgaagaagataaatctgatgta
tcaggattagattttggaacagaaaacactcgacctgtccattccagcaggcgatataga
gagaagtcttcaagatctcagtctgcacaagaaagtaccgtgactacagagaatgctgga
acttcagatatctccataactccaaggactttatcttgcacatctagttatgaaagaggt
ggtagcaataggcatcgagaagaacataggcgtgacagaagtgaaactccgcggtcaaga
cagagaaacacttatgatgagatggatcactaccgacggagggaatcttatcgccaatct
gaccgagactatcacggagaaaagcgtaggagatacaatagcgattggaggactccaggt
aggtcagactgggatgatggacaggacgaatgggaacgtagtcctcacggagacagaggc
tctagttacagcaggcgacctcaaccttctccatcacccatgttagctgcagcttcacct
gatgctcgtttagcctccccgtggctggatacaccacgttcaactatgtcttctgcttct
ccatgggatatgggtgcaccttctcctattccaattcgggcttctggatcatctatcaga
tcctcaagctctaggtatggtggaagatccaatcagcttgcatattctagggaaggtgat
ctgacaaatgaggggcattcagatgaggatagatcgcaaggagctgaagaatttaaacat
gagatcacagaaacaatgcgtgtggaaatggaatatcagtcagatcgtgcatggtatgat
acagacgaagggaactcactgtttgatgcggacagtgcatccttttttcttggagatgat
gcttctctacagaagaaggaaactgaactggcaaagagactggttagaagagacggtagc
aaaatgtcactcgctcagagtaaaaaatattctcagctcaatgcggataatgctcaatgg
gaagaccgccagcttctcagatctggagctgttagaggcacagaagtgcagactgagttt
gatagcgaagaagaacggaaagcaattcttcttgtacatgatacgaagcctcctttcctt
gatggaagagtcgtttacacaaagcaagcagagccagtaatgcctgtaaaggatcccaca
tcagacatggctataatttcacgaaaaggctcaggtcttgtcaaagaaattcgggagaaa
caaagtgcgaataagtcacgacagcgattctgggagcttgcaggttctaatcttggtaat
atccttggtattgaaaaatcagccgagcagattgatgccgatactgctgtagttggtgac
gacggtgaagtagattttaaaggtgaggctaaatttgcacaacatatgaagaagggagaa
gctgtgagtgaatttgccatgtcaaagaccatggcagagcaacggcagtatcttcccata
ttttctgttagagatgaactattgcaggtaataagagaaaaccaggtgatagtggtggtt
ggcgaaactggttcgggaaagaccactcaacttacacagtatcttcatgaggatggttac
actataaatggtatagttggttgcacccaaccaaggcgtgtagcagccatgagtgttgca
aagagagttagtgaagagatggaaacagagttgggcgataaaattggttatgcaattcgt
tttgaagatgtaactggtccaaacactgttatcaagtacatgaccgatggagtactactg
agagagaccctcaaagattctgacctggataagtatcgtgtggtggtgatggatgaagcg
catgaaaggtcactcaacacagacgtcctttttggaatactgaaaaaagttgtggctcgg
cgtcgtgatttcaagctgatagtcacgtcagcaacccttaatgctcaaaagttttccaat
ttctttgggagtgttcctatcttcaacattcctggaaggactttccctgtcaatattctc
tactctaaaactccttgtgaagactatgttgaagctgctgttaaacaggcaatgacgatt
cacataacaagcccacctggggacattctcatttttatgaccgggcaagatgagattgag
gcagcgtgcttttcactaaaggagagaatggaacagctcgtatcatcttccagtagagaa
ataacgaacctactcattctcccaatatactctcagttacctgctgacttgcaagcaaag
atattccagaaaccagaagatggagcccgtaaatgcattgttgccaccaatattgctgaa
acatcattgacagtcgatggaatatattatgtgattgacactgggtatggaaagatgaag
gttttcaatcctagaatgggtatggatgctcttcaagttttccccataagtcgtgcagcc
tctgatcagcgtgctggaagagctggaaggacagggccaggaacatgttacaggttgtat
actgagagtgcttatttgaatgagatgttgccaagtcctgtgccagagattcagcggacg
aatctgggtaatgttgtgttgttgttgaagtcattgaaaatagacaacttgctagatttt
gatttcatggatccacctccgcaagagaacatccttaactctatgtaccagctttgggtg
ttgggtgctctcaacaatgttggaggattaaccgacctggggtggaagatggtggagttc
ccattggatcctcctcttgcaaagatgcttttaatgggtgaacggcttgattgcatagat
gaggttctgacgatcgtgtcaatgctttcagtaccttcagtgttcttcagacctaaagaa
agagcagaagagagcgacgctgcaagggagaagttttttgtgccggaatcggatcatctg
acgctgctgaacgtatatcagcagtggaaagagcatgactatagaggagactggtgcaat
gaccattacctacaagtgaaaggtttgagaaaagctagagaggtaagatcccagcttctg
gatatcctcaagcaactgaaaattgaactcaggtcgtgtggaccggattgggatattgtg
agaaaagccatctgttcagcgtatttccacaactcagctagattaaaaggtgttggggag
tatgtgaactgcagaaccgggatgccttgccatttgcaccctagcagtgcactgtacggt
ctgggatacacaccggactatgtggtgtaccatgaactgatcttgaccacaaaggagtac
atgcagtgtgcgacatcggttgagccgcattggctggctgagttagggcctatgttcttc
tcggtcaaggactcggatacatcgatgttggagcataaaaaaaagcagaaggaagagaaa
tcaggaatggaggaagagatggagaaactgagaagagatcaggtggagtcagagctgaga
agcaaagagagagagagaaaaaaaagggcaaagcagcagcaacagatttcaggccctggc
ttgaaaaagggcaccactttcctcaggcctaagaagcttggactgtga

DBGET integrated database retrieval system