KEGG   Arabidopsis thaliana (thale cress): AT5G13510Help
Entry
AT5G13510         CDS       T00041                                 

Gene name
EMB3136
Definition
(RefSeq) Ribosomal protein L10 family protein
  KO
K02864  large subunit ribosomal protein L10
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AT5G13510 (EMB3136)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ath03011]
    AT5G13510 (EMB3136)
Ribosome [BR:ath03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    AT5G13510 (EMB3136)
  Bacteria
    AT5G13510 (EMB3136)
  Archaea
    AT5G13510 (EMB3136)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L10 F-actin_cap_A
Motif
Other DBs
NCBI-GeneID: 831195
NCBI-ProteinID: NP_196855
MIPS: AT5G13510.1
TAIR: AT5G13510
Araport: AT5G13510
UniProt: Q9FY50 B5X0P0 A0A178UIQ9
Position
5
AA seq 220 aa AA seqDB search
MEVALLSFSSSLSPLCHQRISTLTPKTSNSPNYPRLPVIRSAVSRNKKEETVEAVKSHLE
NCHLLAAINYKGLTVKQFQDLRRTLPDTTKLIVAKNTLVFKAIEGTKWEALKPCMKGMNA
WLFVQTDEIPSAIKPYRSFQKERKLENNDFAGAVFEGKFYAPDNFKVLETMPTRAEVYAK
MLGALQSPAINLVTTLQAPAREVIMVLMAYIKKLEDESNA
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggaagtggctcttctctccttctcttcttccttgtctcctctctgtcaccagcgaatc
tcaactctcacacccaaaacctcgaattccccaaattaccctcgcctcccggtcatcaga
tccgcggtgtctcgtaacaagaaggaagagactgtcgaagccgtcaagtctcacttggag
aactgccatctcctcgccgccatcaactacaaaggcctcaccgtcaagcagtttcaagac
ctccggagaactctccccgacactacaaagctcatcgtcgccaagaacactttggtcttc
aaagccattgaaggcaccaaatgggaagctctcaagccttgtatgaaaggcatgaacgct
tggcttttcgtccagaccgatgaaatcccttctgctatcaaaccctaccggagcttccag
aaggaacgcaagcttgaaaacaatgactttgccggcgctgtcttcgaaggtaagttctac
gctcctgacaatttcaaagtcctcgagaccatgcccactcgtgctgaggtctacgctaag
atgctcggtgctctgcaatctccggctattaatctcgtcactactttacaagcaccagca
agagaggttataatggtgcttatggcttacattaagaagttggaagatgagagtaatgca
tag

DBGET integrated database retrieval system