KEGG   Arabidopsis thaliana (thale cress): AT5G13960
Entry
AT5G13960         CDS       T00041                                 

Gene name
SUVH4
Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH4-like protein
  KO
K11420  [histone H3]-lysine9 N-trimethyltransferase EHMT [EC:2.1.1.355]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00310  Lysine degradation
ath01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    AT5G13960 (SUVH4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ath03036]
    AT5G13960 (SUVH4)
Enzymes [BR:ath01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.355  [histone H3]-lysine9 N-trimethyltransferase
     AT5G13960 (SUVH4)
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     AT5G13960 (SUVH4)
SSDB
Motif
Pfam: SAD_SRA SET Pre-SET
Other DBs
NCBI-GeneID: 831244
NCBI-ProteinID: NP_196900
MIPS: AT5G13960.1
TAIR: AT5G13960
UniProt: Q8GZB6 A0A654G0S6
Structure
PDB: 
4QEN 4QEO 4QEP

Position
5
AA seq 624 aa
MAGKRKRANAPDQTERRSSVRVQKVRQKALDEKARLVQERVKLLSDRKSEICVDDTELHE
KEEENVDGSPKRRSPPKLTAMQKGKQKLSVSLNGKDVNLEPHLKVTKCLRLFNKQYLLCV
QAKLSRPDLKGVTEMIKAKAILYPRKIIGDLPGIDVGHRFFSRAEMCAVGFHNHWLNGID
YMSMEYEKEYSNYKLPLAVSIVMSGQYEDDLDNADTVTYTGQGGHNLTGNKRQIKDQLLE
RGNLALKHCCEYNVPVRVTRGHNCKSSYTKRVYTYDGLYKVEKFWAQKGVSGFTVYKYRL
KRLEGQPELTTDQVNFVAGRIPTSTSEIEGLVCEDISGGLEFKGIPATNRVDDSPVSPTS
GFTYIKSLIIEPNVIIPKSSTGCNCRGSCTDSKKCACAKLNGGNFPYVDLNDGRLIESRD
VVFECGPHCGCGPKCVNRTSQKRLRFNLEVFRSAKKGWAVRSWEYIPAGSPVCEYIGVVR
RTADVDTISDNEYIFEIDCQQTMQGLGGRQRRLRDVAVPMNNGVSQSSEDENAPEFCIDA
GSTGNFARFINHSCEPNLFVQCVLSSHQDIRLARVVLFAADNISPMQELTYDYGYALDSV
HGPDGKVKQLACYCGALNCRKRLY
NT seq 1875 nt   +upstreamnt  +downstreamnt
atggctggaaaaaggaaacgagctaatgctcctgaccaaacagagcgaagatcgagtgtt
cgggttcagaaagtgagacagaaagcgttagatgagaaggcgcgtttagtacaggagagg
gttaagctcctcagtgacagaaagagtgaaatttgtgtcgatgacactgagttacatgag
aaagaagaggaaaatgtcgatgggagccctaaacgaagaagccctccaaagctaaccgca
atgcagaaaggaaagcagaaattgagtgtttctctgaatggtaaggacgtgaacttggaa
cctcatctcaaagtgacaaagtgtctgaggttatttaacaagcaatatctcctctgtgtc
caggctaagttgagcaggcctgatttgaagggtgtaactgagatgataaaagctaaggcg
atattgtacccaagaaaaataatcggtgaccttccaggtatagacgttggacaccgtttt
ttttcaagagctgaaatgtgtgctgtaggattccataaccattggctaaatggcattgat
tatatgtcaatggaatacgaaaaagagtatagtaactacaaattaccgcttgctgtttct
attgttatgtcgggccagtacgaggatgatctagacaatgcagatacagtgacttacact
ggacagggagggcataacttaactggtaataaacgtcagataaaggatcaacttttagaa
cgagggaatttggcgctaaagcactgctgcgaatataatgtgcctgtcagagtaactcgt
ggtcacaattgcaaaagtagctataccaaacgagtatacacttatgatggactgtacaag
gttgaaaagttctgggcacaaaagggcgtttcaggatttacagtgtataagtaccgactg
aaacgattggaggggcaaccagaactaactactgatcaggtcaactttgttgctggacgc
ataccaacgagtacttcagaaattgagggtttggtatgtgaggacatctccggagggcta
gaatttaagggtatccccgccactaatcgtgttgatgattcaccagtttcaccaacatct
ggtttcacatacatcaaatctttgattattgagcctaatgtcataattccaaagagttca
actgggtgtaactgccgaggcagctgcactgactcaaagaaatgtgcatgtgctaagctt
aatgggggtaactttccatatgttgaccttaatgatggcagattaattgagtctcgagat
gttgtatttgaatgtggtcctcactgtgggtgtgggccaaaatgtgtcaaccgaacttct
cagaagcgtctaagattcaatcttgaggttttccgctctgcaaagaagggttgggcagtt
agatcatgggagtacataccagctggttcaccagtatgtgagtacataggagttgtcagg
agaactgctgatgtggatactatctctgacaatgaatacatatttgagattgactgccaa
cagacaatgcaaggtcttggtggaagacagagaagactaagagatgttgctgtaccaatg
aataatggagtcagtcagagcagtgaagatgagaatgcgccagagttctgcattgatgct
ggttcaacaggaaactttgctaggtttataaatcacagttgtgaaccaaacctatttgtt
cagtgcgtcctgagttctcaccaggatataaggcttgcccgtgtggttcttttcgcagct
gacaacatttccccaatgcaggagctcacttacgactatggatatgcgcttgatagcgtt
catggaccggatgggaaggtgaagcagctcgcttgctactgtggagcgctaaattgtagg
aaacgcctttactaa

DBGET integrated database retrieval system