KEGG   Arabidopsis thaliana (thale cress): AT5G14220Help
Entry
AT5G14220         CDS       T00041                                 

Gene name
HEMG2
Definition
(RefSeq) Flavin containing amine oxidoreductase family
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00860  Porphyrin and chlorophyll metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Module
ath_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AT5G14220 (HEMG2)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     AT5G14220 (HEMG2)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     AT5G14220 (HEMG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 FAD_binding_2 DAO HI0933_like Pyr_redox FAD_oxidored Thi4 Pyr_redox_2 Prenylcys_lyase AlaDh_PNT_C FMO-like IlvN FAD_binding_3 GIDA Pyr_redox_3 NAD_binding_9 3HCDH_N 2-Hacid_dh_C NAD_binding_7
Motif
Other DBs
NCBI-GeneID: 831272
NCBI-ProteinID: NP_196926
MIPS: AT5G14220.1
TAIR: AT5G14220
Araport: AT5G14220
UniProt: Q8S9J1 A0A178URA2
Position
5
AA seq 508 aa AA seqDB search
MASGAVADHQIEAVSGKRVAVVGAGVSGLAAAYKLKSRGLNVTVFEADGRVGGKLRSVMQ
NGLIWDEGANTMTEAEPEVGSLLDDLGLREKQQFPISQKKRYIVRNGVPVMLPTNPIELV
TSSVLSTQSKFQILLEPFLWKKKSSKVSDASAEESVSEFFQRHFGQEVVDYLIDPFVGGT
SAADPDSLSMKHSFPDLWNVEKSFGSIIVGAIRTKFAAKGGKSRDTKSSPGTKKGSRGSF
SFKGGMQILPDTLCKSLSHDEINLDSKVLSLSYNSGSRQENWSLSCVSHNETQRQNPHYD
AVIMTAPLCNVKEMKVMKGGQPFQLNFLPEINYMPLSVLITTFTKEKVKRPLEGFGVLIP
SKEQKHGFKTLGTLFSSMMFPDRSPSDVHLYTTFIGGSRNQELAKASTDELKQVVTSDLQ
RLLGVEGEPVSVNHYYWRKAFPLYDSSYDSVMEAIDKMENDLPGFFYAGNHRGGLSVGKS
IASGCKAADLVISYLESCSNDKKPNDSL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctggagcagtagcagatcatcaaattgaagcggtttcaggaaaaagagtcgca
gtcgtaggtgcaggtgtaagtggacttgcggcggcttacaagttgaaatcgaggggtttg
aatgtgactgtgtttgaagctgatggaagagtaggtgggaagttgagaagtgttatgcaa
aatggtttgatttgggatgaaggagcaaacaccatgactgaggctgagccagaagttggg
agtttacttgatgatcttgggcttcgtgagaaacaacaatttccaatttcacagaaaaag
cggtatattgtgcggaatggtgtacctgtgatgctacctaccaatcccatagagctggtc
acaagtagtgtgctctctacccaatctaagtttcaaatcttgttggaaccatttttatgg
aagaaaaagtcctcaaaagtctcagatgcatctgctgaagaaagtgtaagcgagttcttt
caacgccattttggacaagaggttgttgactatctcatcgacccttttgttggtggaaca
agtgctgcggaccctgattccctttcaatgaagcattctttcccagatctctggaatgta
gagaaaagttttggctctattatagtcggtgcaatcagaacaaagtttgctgctaaaggt
ggtaaaagtagagacacaaagagttctcctggcacaaaaaagggttcgcgtgggtcattc
tcttttaaggggggaatgcagattcttcctgatacgttgtgcaaaagtctctcacatgat
gagatcaatttagactccaaggtactctctttgtcttacaattctggatcaagacaggag
aactggtcattatcttgtgtttcgcataatgaaacgcagagacaaaacccccattatgat
gctgtaattatgacggctcctctgtgcaatgtgaaggagatgaaggttatgaaaggagga
caaccctttcagctaaactttctccccgagattaattacatgcccctctcggttttaatc
accacattcacaaaggagaaagtaaagagacctcttgaaggctttggggtactcattcca
tctaaggagcaaaagcatggtttcaaaactctaggtacacttttttcatcaatgatgttt
ccagatcgttcccctagtgacgttcatctatatacaacttttattggtgggagtaggaac
caggaactagccaaagcttccactgacgaattaaaacaagttgtgacttctgaccttcag
cgactgttgggggttgaaggtgaacccgtgtctgtcaaccattactattggaggaaagca
ttcccgttgtatgacagcagctatgactcagtcatggaagcaattgacaagatggagaat
gatctacctgggttcttctatgcaggtaatcatcgaggggggctctctgttgggaaatca
atagcatcaggttgcaaagcagctgaccttgtgatctcatacctggagtcttgctcaaat
gacaagaaaccaaatgacagcttataa

DBGET integrated database retrieval system