KEGG   Arabidopsis thaliana (thale cress): AT5G16530Help
Entry
AT5G16530         CDS       T00041                                 

Gene name
PIN5
Definition
(RefSeq) Auxin efflux carrier family protein
  KO
K13947  auxin efflux carrier family
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT5G16530 (PIN5)
Transporters [BR:ath02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   AT5G16530 (PIN5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mem_trans
Motif
Other DBs
NCBI-GeneID: 831515
NCBI-ProteinID: NP_197157
MIPS: AT5G16530.1
TAIR: AT5G16530
Araport: AT5G16530
UniProt: Q9FFD0 A0A178UIR3
Position
5
AA seq 351 aa AA seqDB search
MINCGDVYKVIEAMVPLYVALILGYGSVKWWHIFTRDQCDAINRLVCYFTLPLFTIEFTA
HVDPFNMNYRFIAADVLSKVIIVTVLALWAKYSNKGSYCWSITSFSLCTLTNSLVVGVPL
AKAMYGQQAVDLVVQSSVFQAIVWLTLLLFVLEFRKAGFSSNNISDVQVDNINIESGKRE
TVVVGEKSFLEVMSLVWLKLATNPNCYSCILGIAWAFISNRWHLELPGILEGSILIMSKA
GTGTAMFNMGIFMALQEKLIVCGTSLTVMGMVLKFIAGPAAMAIGSIVLGLHGDVLRVAI
IQAALPQSITSFIFAKEYGLHADVLSTAVIFGMLVSLPVLVAYYAALEFIH
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgataaattgtggagatgtttacaaggtaatcgaagcaatggttccactctatgtagcc
ttaatcttaggctatggctctgtgaaatggtggcacatcttcacgcgtgatcaatgtgat
gctataaaccgtctcgtttgctatttcaccctgccgctcttcaccattgagttcacggcc
catgtcgacccgttcaacatgaattaccggttcatcgcggccgatgtcctctctaaggtc
atcatagtcacggtcttagcgttgtgggccaaatatagcaacaaaggaagctattgttgg
tccattactagtttctctctatgcactcttactaactctcttgtcgttggtgtgccattg
gctaaggcaatgtacggacaacaggctgttgatctggtggttcaatcctcggtatttcaa
gccatcgtgtggctcacactcttgttgtttgtcttagagtttagaaaagccggatttagt
agtaataatatcagcgacgtacaagtagacaacatcaatatcgaaagtggaaaaagagaa
actgtggttgtgggagagaagtcgttccttgaggtcatgtccctcgtttggttgaagctt
gcaacgaatccaaattgctattcttgcatccttgggatcgcatgggcttttatttctaac
agatggcatctggagctgccgggcatattagagggttcgattcttataatgtcaaaagca
ggaacaggaacggccatgttcaatatgggaatattcatggcacttcaagaaaagttgata
gtatgtggaacaagcttgactgtgatgggaatggtattgaagtttattgccggaccggcg
gccatggccatcggctctattgtccttggcctccacggtgatgtcctccgcgtagccatc
attcaggctgctttgccacaatcgattacttcgttcatttttgctaaggaatatggatta
catgcagatgttctaagcacagcggtgatatttgggatgttggtctctctacctgtgctc
gtcgcctactacgcagctctggagtttattcattga

DBGET integrated database retrieval system