KEGG   Arabidopsis thaliana (thale cress): AT5G16830Help
Entry
AT5G16830         CDS       T00041                                 

Gene name
SYP21
Definition
(RefSeq) syntaxin of plants 21
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Syntaxin_2 SNARE Syntaxin DUF3053 Prominin SpoIISA_toxin Orf78 RE_BstXI Synaptobrevin MCPsignal
Motif
Other DBs
NCBI-GeneID: 831546
NCBI-ProteinID: NP_197185
MIPS: AT5G16830.1
TAIR: AT5G16830
Araport: AT5G16830
UniProt: Q39233 Q1WW70 A0A384LDU7
Position
5
AA seq 279 aa AA seqDB search
MSFQDLEAGTRSPAPNRFTGGRQQRPSSRGDPSQEVAAGIFRISTAVNSFFRLVNSIGTP
KDTLELRDKLQKTRLQISELVKNTSAKLKEASEADLHGSASQIKKIADAKLAKDFQSVLK
EFQKAQRLAAEREITYTPVVTKEIPTSYNAPELDTESLRISQQQALLLQSRRQEVVFLDN
EITFNEAIIEEREQGIREIEDQIRDVNGMFKDLALMVNHQGNIVDDISSNLDNSHAATTQ
ATVQLRKAAKTQRSNSSLTCLLILIFGIVLLIVIIVVLV
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgagtttccaagatctcgaagctggtactcgatctccggcgccgaatcgttttaccggt
gggagacaacagagaccttcgtctcgtggggatccatctcaggaggtcgccgccgggatt
ttcaggatcagcacggctgtcaattccttcttccgcctcgttaattcgatcggaacacct
aaagatactcttgaattacgagataagctgcaaaagacaaggttacagatatccgaattg
gtgaagaatacttcagctaaacttaaggaagctagcgaagccgaccttcatggatcagct
agtcaaattaagaagatagctgatgctaaactggcaaaagatttccaatcagttctcaaa
gagtttcagaaagctcagagacttgcagctgaaagagaaataacatatactcctgtggtc
acaaaagaaatacctaccagttataatgcacctgaactggatactgaatctttaaggatc
tcccagcagcaagctcttcttctacaatcaagaaggcaagaagtggtgtttttagataac
gagataacattcaatgaagcaattattgaggaaagagagcaagggattcgagaaattgaa
gaccagattcgtgatgtgaatggcatgttcaaagatctagctcttatggtgaaccatcaa
ggaaatattgtcgatgacatcagctctaaccttgacaactcacatgctgcaactacacaa
gccactgttcaactcagaaaagcagctaaaactcaaagatcaaactcctctttgacatgc
ctacttattctcatttttgggattgttctactcattgtcatcatcgttgtcttggtctaa

DBGET integrated database retrieval system