KEGG   Arabidopsis thaliana (thale cress): AT5G17010Help
Entry
AT5G17010         CDS       T00041                                 

Definition
(RefSeq) Major facilitator superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1 TRI12 PolC_DP2
Motif
Other DBs
NCBI-GeneID: 831564
NCBI-ProteinID: NP_001318578
MIPS: AT5G17010.1
TAIR: AT5G17010
Araport: AT5G17010
UniProt: Q6AWX0 A0A178UGZ3
Position
5
AA seq 503 aa AA seqDB search
MALDPEQQQPISSVSREFGKSSGEISPEREPLIKENHVPENYSVVAAILPFLFPALGGLL
YGYEIGATSCATISLQSPSLSGISWYNLSSVDVGLVTSGSLYGALFGSIVAFTIADVIGR
RKELILAALLYLVGALVTALAPTYSVLIIGRVIYGVSVGLAMHAAPMYIAETAPSPIRGQ
LVSLKEFFIVLGMVGGYGIGSLTVNVHSGWRYMYATSVPLAVIMGIGMWWLPASPRWLLL
RVIQGKGNVENQREAAIKSLCCLRGPAFVDSAAEQVNEILAELTFVGEDKEVTFGELFQG
KCLKALIIGGGLVLFQQITGQPSVLYYAPSILQTAGFSAAGDATRVSILLGLLKLIMTGV
AVVVIDRLGRRPLLLGGVGGMVVSLFLLGSYYLFFSASPVVAVVALLLYVGCYQLSFGPI
GWLMISEIFPLKLRGRGLSLAVLVNFGANALVTFAFSPLKELLGAGILFCGFGVICVLSL
VFIFFIVPETKGLTLEEIEAKCL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttgatcctgagcagcagcaaccaatctcctctgtttccagagagtttggtaag
tcatctggtgagatcagcccagaaagggagcctcttattaaagagaatcatgtcccagaa
aactactctgtcgttgccgccattctcccgtttttatttccagctctcggaggactgctt
tatggttatgaaattggtgcaacttcttgtgcaaccatttcacttcagtcgccttcatta
agtggaatttcatggtacaacttgtcctcagtggatgttggtctagttaccagtggctca
ctttacggtgcattatttggctcaattgtggcttttactatcgctgacgttataggaaga
agaaaggagctgattttggctgcattattgtatctcgttggagcccttgtgactgcacta
gccccaacctattccgttctgataattggacgggttatttatggggtctcagttggactg
gcaatgcatgcggctccgatgtacattgcagagactgctccaagtccgatacgtggacag
ctggtatcattaaaggaattcttcatagtccttgggatggttggaggttatggaatcggt
agtcttacagtcaatgttcattctggttggcgatacatgtatgcaacaagtgtccctttg
gcagttattatgggaattgggatgtggtggctcccagcatcccctaggtggcttttgttg
cgcgtcatacaggggaaagggaatgtggagaaccaacgagaggctgcaatcaaatctctc
tgctgccttagaggccctgcttttgttgattcagctgctgaacaagtaaatgagattttg
gctgaactaacttttgtgggcgaggataaagaagtcacatttggtgaattatttcaaggg
aagtgcttgaaagctctcatcataggaggaggtctagtcttgtttcagcagataactgga
caaccaagtgtgctttattatgcaccatcaatactgcagaccgctggcttttcagccgca
ggtgatgcaacaagggtctcaattctacttggtctattgaagttgattatgacaggagta
gctgttgtagttatcgacagacttggaaggagacctttacttcttggtggagttggtggc
atggttgtttcattattcctgctggggtcatactacctctttttcagcgcctcaccagtt
gttgctgtagttgcactgctgctttatgtgggctgttaccagctatcttttggtccaatt
ggttggctgatgatttcagagatatttccccttaaactaagaggtcgaggtctcagtcta
gcagtgcttgtgaattttggtgcaaacgcacttgtgacatttgcgttttcacccctaaag
gaactgctgggagctgggatactgttttgtgggtttggtgtgatatgtgtattgtctctg
gtattcatattcttcattgtgccagagacaaagggtctcactcttgaggaaattgaagcc
aaatgtctctaa

DBGET integrated database retrieval system